SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238922196|ref|YP_002935710.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238922196|ref|YP_002935710.1|
Domain Number 1 Region: 270-472
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 5.93e-41
Family NodB-like polysaccharide deacetylase 0.00024
Further Details:      
 
Weak hits

Sequence:  gi|238922196|ref|YP_002935710.1|
Domain Number - Region: 238-268
Classification Level Classification E-value
Superfamily PKD domain 0.0102
Family PKD domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238922196|ref|YP_002935710.1|
Sequence length 484
Comment hypothetical protein EUBELI_20431 [Eubacterium eligens ATCC 27750]
Sequence
MKKAIMKYLLIGSACVLFAVLGMVTYKKSQENKIVFTISDKICVSYGDNIDISNMQVIKN
QHLHEKKNKTHITVEGDVNTRKIGDYDIDVIVRKGNKKASKKIVVEVADVEAPVIELSGD
SEMTIEAGTQYEEPGFSADDNYDGDLTEKVEKNNDIDTCTKQDVIITYSVKDSSGNEAVA
NRTVHIVDTTPPQITLTQGSTCYVKCGTEYMEAGYYAEDICDGDITDKVQVTGDVNTSEC
GSYTVSYKVSDSSGNTAEAERTVRVYKPMTDNVVNPGDKVVYLTFDDGPGPYTQELLDVL
DRYNVKATFFVTNGKPDYQNLIAEEASRGHTVAIHSASHDYSRIYQSVDAYFDDLNEMNN
IILTQTGKYADIIRFPGGSSNTVSRSYCEGIMSQLVCAVEAKGFRYCDWNVSSGDAGSAN
TASQVICNVINGIKGRNISIVLQHDIKKFSVDAVEEIIQWGLSEGYTFLPITSTTPMSHH
GINN
Download sequence
Identical sequences C4Z6I4
515620.EUBELI_20431 WP_012740704.1.74791 gi|238922196|ref|YP_002935710.1| gi|238922196|ref|YP_002935710.1|NC_012780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]