SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238922200|ref|YP_002935714.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238922200|ref|YP_002935714.1|
Domain Number 1 Region: 159-245
Classification Level Classification E-value
Superfamily DEATH domain 0.000053
Family DEATH domain, DD 0.024
Further Details:      
 
Weak hits

Sequence:  gi|238922200|ref|YP_002935714.1|
Domain Number - Region: 2-29
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00754
Family SSO2064-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238922200|ref|YP_002935714.1|
Sequence length 249
Comment hypothetical protein EUBELI_20435 [Eubacterium eligens ATCC 27750]
Sequence
MKCNNCGAPIQMNQKFCPNCGSPNVEFKKHIDDMEQYNKKFNSTRSKVIGNSKWFVKYIA
PITALVITMTALTLAIIGKNSMIGYDIARKNQQKYYSSHSDEIQTKLKLLLEAGDYATLY
SMDYVGDCSIKDNDDKYAWNDFYNVAGDYVYIRKGIISMMERNNSSYYGDEYMNTISRAV
ADMEDILSRRLNLSYHSVSKESIKYINDIYEKSHELLKAYCNLTDEDIAGLPDMSQADIL
TLITRRSFE
Download sequence
Identical sequences C4Z6I8
515620.EUBELI_20435 gi|238922200|ref|YP_002935714.1| gi|238922200|ref|YP_002935714.1|NC_012780 WP_012740708.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]