SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238922253|ref|YP_002935767.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238922253|ref|YP_002935767.1|
Domain Number 1 Region: 38-226
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.57e-71
Family HD domain 0.00000258
Further Details:      
 
Domain Number 2 Region: 228-403
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 7.85e-63
Family RelA/SpoT domain 0.00000698
Further Details:      
 
Domain Number 3 Region: 421-488
Classification Level Classification E-value
Superfamily TGS-like 4.8e-19
Family TGS domain 0.031
Further Details:      
 
Domain Number 4 Region: 692-768
Classification Level Classification E-value
Superfamily ACT-like 0.000000000195
Family Glycine cleavage system transcriptional repressor 0.07
Further Details:      
 
Weak hits

Sequence:  gi|238922253|ref|YP_002935767.1|
Domain Number - Region: 492-546
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 0.0153
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238922253|ref|YP_002935767.1|
Sequence length 770
Comment GTP pyrophosphokinase [Eubacterium eligens ATCC 27750]
Sequence
MEARMPENIELPGASHNKTNQVERAVDTPADFTSPEELYKDLIAAIKKYHPSTDLSDIEK
AYETARKAHEGQFRKSGEPYIIHPLCVAIILAELELDKESIIAGLLHDVVEDTVMTSEDV
AKEFGDEVALLVDGVTKLTQLNYQHDKIEVQAENLRKMFLAMAKDIRVILIKLADRLHNM
RTMQYQSPAKQIEKSRETMEIYAPIAHRLGISKIKVELDDLSMKYLMPDVYNDLVEQVNL
NRPGREAFIKSIIKEVGMHISNAGIEAEIDGRVKHFFSIYRKMVNQNKTLDQIYDIFAVR
IKVDTVKDCYAALGVIHEMYKPIPGRFKDYIAMPKPNNYQSLHTTLIASNGQPFEIQIRT
YEMHKIAEYGIAAHWKYKEGKTGEKDNQSEEAKLSWLRQILEWQKEMSDNKEFLSSIKND
LNLFSDSVYCFTPSGDVKNLPAGSCPIDFAYSIHSAVGNKMVGARVNGKLVTIDYVIKNG
DRIEIITSQNSKGPSRDWLSIVKSTQAKNKINQWFKQELKEDNIIKGKEMIVNYCKTKGI
VLSDITKPEYVEKCLNKYGFKDWDSILAAVGHGALKESQIVNRLNEEHLKTKKAEVTDKD
VLEEIVAAESKEKSKKKEGKGGIVVKGIHDVAVRFSKCCNPVPGDEIVGFVTRGRGISIH
RTDCVNIINFPANERARLIEAEWEQGQTAGDTYEVEINIFANNRTGLIVDISRMFTEAEI
DVKSMNCRLNKKEVATISVGFDIHGKEELNRIIDKLRKIDGVTDITRTAG
Download sequence
Identical sequences C4Z6P1
WP_012740760.1.74791 gi|238922253|ref|YP_002935767.1| gi|238922253|ref|YP_002935767.1|NC_012780 515620.EUBELI_20488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]