SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238922281|ref|YP_002935795.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238922281|ref|YP_002935795.1|
Domain Number 1 Region: 1-148
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 3.01e-40
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0014
Further Details:      
 
Domain Number 2 Region: 169-270
Classification Level Classification E-value
Superfamily PTS system IIB component-like 5.23e-37
Family PTS system, Fructose specific IIB subunit-like 0.0000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238922281|ref|YP_002935795.1|
Sequence length 634
Comment protein-Np-phosphohistidine-sugar phosphotransferase [Eubacterium eligens ATCC 27750]
Sequence
MRITDLLDKRSINLNAAPKTKSEALDMAVELMAKSGKIDDIESYKAKVYAREEESTTGVG
EGIAIPHGKCSAVNAPGLAAMIIKDGVDFESLDDEPVKVLFLIAAPDTKDNVHLDVLSKL
SVLLMDENFVAKLMKAGSPEEFLEIIDGADEEAKSIDERLEKEDDKLAKILAVTSCPTGI
AHTYMAAEGLEKAAAKAGCAIKIETRGSGGAKNVLTDEDIESAECIIVAADAQVPMERFD
GKKVIECQVSDGINKADELIKKALAGDAPVYKAGTSEKKESTSAKKGGGIGHKIYTQLMN
GVSHMLPFVVGGGILIAIAFLIDGLNVDMNALSEAERSNFGTITPVAALFKSIGGAAFGF
MLPVLAGFIAMAIGDRPALALGFVGGYIAANGKSGFLGALVAGFAAGYIIVLLRKICDKL
PEALEKIAPVLIYPVVGILVIGLGMTFIVEPVMGGINTGLNSFLAGMGSTSRVLLGFILA
AMMAIDMGGPFNKAAYVFGTASIAAGNYDIMAAVMIGGMVPPCAIALATILFKNKFTKEE
RDAGPTNFIMGLAFITEGAIPYAAADPLHVIPACIIGSGAAGAVSMFFKCTLMAPHGGIF
VFPVVGNAIYYVIALVAGTIISTICLGLFKKKAA
Download sequence
Identical sequences C4Z6R9
gi|238922281|ref|YP_002935795.1| 515620.EUBELI_20517 WP_012740788.1.74791 gi|238922281|ref|YP_002935795.1|NC_012780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]