SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238922327|ref|YP_002935841.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238922327|ref|YP_002935841.1|
Domain Number 1 Region: 8-248
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.21e-87
Family ABC transporter ATPase domain-like 0.000000616
Further Details:      
 
Domain Number 2 Region: 243-346
Classification Level Classification E-value
Superfamily MOP-like 0.0000000000000167
Family ABC-transporter additional domain 0.016
Further Details:      
 
Domain Number 3 Region: 386-474
Classification Level Classification E-value
Superfamily MOP-like 0.00000000238
Family ABC-transporter additional domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238922327|ref|YP_002935841.1|
Sequence length 480
Comment spermidine/putrescine transport system ATP-binding protein [Eubacterium eligens ATCC 27750]
Sequence
MSGKSENIIELKHISKVYSDNGFKAVDDFNLEVKRGEFVTFLGPSGCGKTTTLRMIAGFE
LPTDGQILLNGEDISQLPANKRPINTVFQRYALFPHMNIYENIAFGLKLKKLPKEEIRKK
VKNVLDMVDLEGFEDRKISTLSGGQQQRIAIARALVNEPEILMLDEPLGALDLKMRKEMQ
IELKNMHDQLGITFIYVTHDQEEALTMSDKIVVLSEGKIQQIGTPEDIYNEPKNAFVADF
IGESNIFKGIMTGHMKVRFCGGEFVGMDDVPEGTLVDVVIRPEDVIITKPEDGTVVGEVT
SVIFKGMHYEVAVESGKYEMIIRTTRCYHVGDTVGMQLEPDGIHVMLAEDHTTSFVTTIN
GDYTLDFNGKIISCDLTQVIPKTKMSDGVLVDENGENVDVSKFRVVVSIQPDDIEMSDDV
TAGLVSGKIINLIYKGDHYSYVIRTEYGHDLIVDDEYLWNMDDQVGLIMPEEKMKFQLKK
Download sequence
Identical sequences C4Z6W5
515620.EUBELI_20563 gi|238922327|ref|YP_002935841.1| WP_012740834.1.74791 gi|238922327|ref|YP_002935841.1|NC_012780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]