SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238922365|ref|YP_002935879.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238922365|ref|YP_002935879.1|
Domain Number 1 Region: 19-130
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000000000000118
Family HD domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238922365|ref|YP_002935879.1|
Sequence length 195
Comment hypothetical protein EUBELI_20601 [Eubacterium eligens ATCC 27750]
Sequence
MEHISRNDAFELLKKYNIDPFHIQHALTVEAVMKWYANELGYGEDAEYWGIVGLLHDIDF
ELYPEQHCIKAPELLREGGVSEDIIHGVVSHGYGITVDVAPEHEMEKVLFAADELTGLIW
AAALMRPSKSTKDMELKSLKKKYKSKGFAAGCSREVIERGAEQLGWGLDELLTKTLAAMA
ASEDTINEEMEKENV
Download sequence
Identical sequences C4Z703
WP_012740872.1.74791 gi|238922365|ref|YP_002935879.1| 515620.EUBELI_20601 gi|238922365|ref|YP_002935879.1|NC_012780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]