SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238916261|ref|YP_002929778.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916261|ref|YP_002929778.1|
Domain Number 1 Region: 447-541
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000706
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238916261|ref|YP_002929778.1|
Sequence length 744
Comment cadherin EGF LAG seven-pass G-type receptor 3 [Eubacterium eligens ATCC 27750]
Sequence
MLIYFYRNLIKGRCILKNVSLKNIQKDIVSGIIVALVSIPISMGYAQIAGLPAVYGLYCS
ILPVLIYGLVTSSPQFVLGVDATPAALVGGTLATLGIVSGSEEAKAVVPSITLVAALWLL
LFFFIKAGRIVNYISTPVMGGFISGIGVTIILMQTAKLFGGNAGTGEAIKLLIHIAGEMK
SFNLLSAVLGVGTVVIILVAKKFIPKFPMSVLLMVVGALATAIFHIDRFGVKLLPHVDKG
LPGFSLPDMSVVFKNPSDIILLGLSVAGVVMAQTLLATNNYANKYGYKVSNNREILSYAA
ANAASAVIGGCPLNGSVSRTGIADQFGCKSQVMSITASLTMLLIVLFGTPVLEYLPVPIL
TGIVVAALIGITEFGLAVKLWKTDHTEFAIFVGAFLGVLLFGTIHGVVIGVILSFIAVIV
KAVEPPRAFLGVIPGQEGFYSLNRYRNVKKIKGAVIYRFNGALFFANINTFVDDIEKNLD
DNTKWVIVDAGGVGSIDVTAVDRLMSLYKALEKKGIRFYITEHEHTLNDQLRELGAGEFV
EKGVVRRTIPLALRDAGLDRPYPVEEGEEEQAVSGEAHEDNERLAEIEWAFGADADEWLE
KMAAEMADEIGSVKKDEKNVIVDAEKHAAWGRIGLFDENELLERLEMHLFDDKKYPNLDI
DDIEKRIDERRVVVEKKLAQINPDAIQMLKEHRKQMLDRVKLHNPYAYEHTMEQRRKHYE
HLQKKDPELAQKLKNFYNLSDDDK
Download sequence
Identical sequences C4Z2S6
515620.EUBELI_00295 WP_012738568.1.74791 gi|238916261|ref|YP_002929778.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]