SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|240047143|ref|YP_002960531.1| from Mycoplasma conjunctivae HRC/581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|240047143|ref|YP_002960531.1|
Domain Number 1 Region: 176-703
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 3.36e-172
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0000000000288
Further Details:      
 
Domain Number 2 Region: 17-175
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 4.71e-48
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|240047143|ref|YP_002960531.1|
Sequence length 720
Comment ribonucleotide-diphosphate reductase subunit alpha [Mycoplasma conjunctivae HRC/581]
Sequence
MNKNKQQINLTGSISEEYIALNAKSKLFTKYKEAYKFDLQAAKSYIQNHIEPKFRKFENF
HQRIQWLIENKFYDPQVINEYTFDELEKLNEQAYSYKHFFPSFMGAFKFYLSYALKSNDG
QQYLEHFEDRALMNALFLARGNYEKASKILRQIMLGRFQPATPTFLNAGKLNRGEFISCY
LIRVEDNMESISRAVTTSLQLSKRGGGVSVLLSNLREQGAPIKKIENQATGVIPVMKILE
DSFSYANQLGQRQGAGAVYLNVHHPDILNFLDTKRENADEKIRIKSLSLGVVIPDITFEL
AKNNQDMALFSVYDVQNEYGKAFSDISITEEYYNLLNNDRIKKTFISARKLFTLIAELHF
ESGYPYILFEDTVNKRNAHPNRIVMSNLCSEIAQPSTPSEYLPDLTFSKIGQDICCNLGS
LNIDKAMKSGKEFGEMVYYSILALDHVSRNSDLSAAPSIEKGNKLNHAVGLGAMNLHGFL
SQNQIFYDSPEALDFTNIFFYTMAFHAFKSSSILAQKFGPFSGFENTKFANGSYFDKYTK
AKSGEFEPKTQKIKEIFAHYKVEIPTKQDWIDLVENIKRVGLANSHLMAIAPTGSISYLN
SCTPSLQPVVSPVEVRKEGKLGRVYVPAYKINFDNMRYYAKGAYELGPIPIINIAAEAQK
HIDQSISLTLFLTDKATTRDLNKAYIHAFKKGCGSIYYVRIRQEVLEDSEKYDECEACVI
Download sequence
Identical sequences C5J5G5
gi|240047143|ref|YP_002960531.1| WP_012751225.1.71054 45361.MCJ_000080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]