SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|240047235|ref|YP_002960623.1| from Mycoplasma conjunctivae HRC/581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|240047235|ref|YP_002960623.1|
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 1.7e-24
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|240047235|ref|YP_002960623.1|
Sequence length 146
Comment PTS system enzyme IIA component [Mycoplasma conjunctivae HRC/581]
Sequence
MKLFDKKMMVFKDIKDWKEVVHEGVRILVENQKATWDLEKAIMESTAQFGAYYVLEKGIA
LLHAPVGAYCIKAAASILLLHNYVTFNNQEDKQAKIIVTLSAPNSNDHIDLISQFANYFG
NQEFKKEAYQANSVEHFLDIVKKYEV
Download sequence
Identical sequences C5J5Q8
45361.MCJ_001070 WP_012751316.1.71054 gi|240047235|ref|YP_002960623.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]