SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|240047391|ref|YP_002960779.1| from Mycoplasma conjunctivae HRC/581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|240047391|ref|YP_002960779.1|
Domain Number 1 Region: 2-176
Classification Level Classification E-value
Superfamily PEBP-like 9.16e-23
Family Prokaryotic PEBP-like proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|240047391|ref|YP_002960779.1|
Sequence length 406
Comment hypothetical protein MCJ_002650 [Mycoplasma conjunctivae HRC/581]
Sequence
MIKIKIPDVQGGVLNTEFGNGNLGKKYRNSVSFPIKWSKVKGARSYCVTLIDYEASGAMG
VVFVHWIAANIKKNKLKWDDSFNQKAQIAQFENSVTDKASMYLLEAFYQEHPNGVYYGPF
PPDTDHNYRLEVYALDVDDIFHGQPHNGNGLFYDDFLELIKNNVIDYGITSFLYRSRTEF
KNQQLIEKNLTPQQLSAPLSQDIEFFKSFDQINFSSHALSARANDYHLLNIDFLGRQGAS
GLYSARSFDLEIYCDNQQVVEYVVLVSSFAEVNSLGVGLINWVKVGIEKNQNHYKTRIEA
QKDSWDSDTDEIKISNSFDSLSAAKIAQISGFENAGVFDFVKQGYGIIYFPLLTNGQGKY
VLEIFGIDEKIDWKQLQSEKTLNAADVLRAIKAKVVAYNKTIFKLL
Download sequence
Identical sequences C5J664
gi|240047391|ref|YP_002960779.1| WP_012751472.1.71054 45361.MCJ_002650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]