SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|240047457|ref|YP_002960845.1| from Mycoplasma conjunctivae HRC/581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|240047457|ref|YP_002960845.1|
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily PTS system IIB component-like 1.02e-20
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|240047457|ref|YP_002960845.1|
Sequence length 96
Comment PTS system enzyme IIB component [Mycoplasma conjunctivae HRC/581]
Sequence
MALKIVAACGNGMGTSMIIKLKVQKIVKELGIDASVEALSMGQSKGLTNSVDVIIASKHL
TSEFLQNQKAKIVGVTNLMDEKEIKEALTPVLAEFK
Download sequence
Identical sequences C5J6D0
45361.MCJ_003310 gi|240047457|ref|YP_002960845.1| WP_012751538.1.71054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]