SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|240047463|ref|YP_002960851.1| from Mycoplasma conjunctivae HRC/581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|240047463|ref|YP_002960851.1|
Domain Number 1 Region: 8-203
Classification Level Classification E-value
Superfamily DhaL-like 1.57e-35
Family DhaL-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|240047463|ref|YP_002960851.1|
Sequence length 545
Comment hypothetical protein MCJ_003370 [Mycoplasma conjunctivae HRC/581]
Sequence
MLKIKDVTAKQLYAAFESAKNHLTNKMEWINSLNVFPVPDGDTGTNMLATFNSGFESIKD
LNMKTNGEIITNFAKGALFGARGNSGVILSQIIRGFKDSWQNRNKITSLDIVSALEHAVT
RAYDSVAKPVEGTILTFIKEVYKIVKKKSNSKTNILDLFALIVKEGRKICDESPKKLKAL
SDAGVTDSGSEGMLVIFEGMYHYFLEGNPIQISQTQPTSIFTFDTKAGHDEFGYCTEVIV
ELSNSEGFNRKKLESKLERRIKSLVIVEQDGVIKIHGHTDKPGNMLNYLQKFGEFAKIKI
ESMDKQADQIIEKKQQMPKKLAMSALISCNNGQGFYEIMKERHTSEVILFDKEKKPSFKD
FSDAIEKIEAKSFFILPNEKNFLLVANQVAKWYKKDNRAKKIIIMPSNNQLMGQYLAEHF
HPDTQWKDNKTFMIEASKRISVFEIFIASKDAKVNGISVKKGQFCAAKDGKIVIVANTFE
EISKQVLQKNINDTTFSVYLTYGKDLSTQKIAQLEKMIQDYPDIDFLVQQGDQDIYHLLI
GIINE
Download sequence
Identical sequences C5J6D6
45361.MCJ_003370 gi|240047463|ref|YP_002960851.1| WP_012751544.1.71054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]