SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|240047749|ref|YP_002961137.1| from Mycoplasma conjunctivae HRC/581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|240047749|ref|YP_002961137.1|
Domain Number 1 Region: 2-139
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 5.1e-23
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|240047749|ref|YP_002961137.1|
Sequence length 140
Comment PTS system mannitol-specific component IIA [Mycoplasma conjunctivae HRC/581]
Sequence
MILKKENIFINQSFENKDSVFDFLSIIFVTNRATTIEYKESMIKRDLDSSVAIGNYLALV
HGDFQGQKYILENSIIFIHLKDDLIWDNQPIRFVIGLALNNKDQMEYIEKIGLAFFDIDN
VNKLLNKANLTKDDVIEFLQ
Download sequence
Identical sequences C5J771
45361.MCJ_006400 gi|240047749|ref|YP_002961137.1| WP_012751827.1.71054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]