SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|240047751|ref|YP_002961139.1| from Mycoplasma conjunctivae HRC/581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|240047751|ref|YP_002961139.1|
Domain Number 1 Region: 390-477
Classification Level Classification E-value
Superfamily PTS system IIB component-like 1.05e-20
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|240047751|ref|YP_002961139.1|
Sequence length 480
Comment PTS system, mannitol-specific IIBC component [Mycoplasma conjunctivae HRC/581]
Sequence
MENILKKIKIRIQTFGGGLSSMIMPIIGIFIAWGLLTSFFIPTGWIPNEQLATMVGVGII
YIIPVLICFLGGFKIYQYRGGAIAGIAAIAAISAGQSSIFAQITGGSAPMLLSVMIFGPL
SAWILKHSEKFWINKIPSGYQMLINNFYLGILGFILLFPIYYISIYGVGYLIKALGIITS
QIGEWKAYPLVALIVEPAKILFLNNAINHGVFTTLGSIEVTEHGKSILFLLESNPGPGLG
LLVFYLIFGKDKSVKSQAGSSIPIHFFGGIHEVYFPFALLRPILIIALILGGAFGNAMFQ
LFGVGAVAPVSPGSIIAQYIQVEKTTTSIIGLTIGIFGSAIVSFLAALGINFLEKLLKRK
QESISLEQAQEIIKDEKSYKNKGKIINYDHIVFACDAGMGSSVMAASIFKKMLKEAQFNS
VEVTNSSISNLSGDEQVIITIESLQQRVYEKNPSAKIITLDQFLNKQAYEKIIAEMKANQ
Download sequence
Identical sequences C5J773
WP_012751829.1.71054 45361.MCJ_006420 gi|240047751|ref|YP_002961139.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]