SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|240047767|ref|YP_002961155.1| from Mycoplasma conjunctivae HRC/581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|240047767|ref|YP_002961155.1|
Domain Number 1 Region: 2-155
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 3.79e-45
Family Obg GTP-binding protein N-terminal domain 0.0000106
Further Details:      
 
Domain Number 2 Region: 158-327
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.56e-41
Family G proteins 0.0000115
Further Details:      
 
Domain Number 3 Region: 345-415
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 7.59e-20
Family Obg GTP-binding protein C-terminal domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|240047767|ref|YP_002961155.1|
Sequence length 416
Comment GTPase ObgE [Mycoplasma conjunctivae HRC/581]
Sequence
MKFLDQVKIQVEAGKGGNGVISFRREAHVDKGGPDGGDGGSGGSIYFVGDSGLNTLLNFY
SLKIIKGNDGENGRSKNRYGAGGSDIFVKVPIGTQVYVENKLMCDVVTTKPYLIAKGGKG
GRGNTKFKTAKNKAPRISENGDLGEFYELQLVLKVMADVGLVGKPNAGKSTLLSQISNAK
PKIANYSFTTLVPQLGLVKLYDKSFVIADLPGLIEGASQGKGLGFTFLKHIERCRVIAHI
IDFGSKEKNPIIDYENICKELNNFNPALSNLPQIIIANKSDLSEFSKNVLSFKKKFPHLE
IVEASLLTDSKINEIKAKMYSLLEKNILNTVEQVEESVVEFTLQKPFIINKKSDNLYEVE
GLEIKKLVQKIPLNSDDNILRFNNKLKNMGIWDELIKMGIKKGDVVKFFNFELEWI
Download sequence
Identical sequences C5J789
gi|240047767|ref|YP_002961155.1| 45361.MCJ_006580 WP_012751845.1.71054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]