SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256810420|ref|YP_003127789.1| from Methanocaldococcus fervens AG86

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256810420|ref|YP_003127789.1|
Domain Number 1 Region: 163-442
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.33e-82
Family RecA protein-like (ATPase-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 450-557
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 5.23e-30
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0026
Further Details:      
 
Domain Number 3 Region: 4-72
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00000000000000667
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|256810420|ref|YP_003127789.1|
Domain Number - Region: 121-179
Classification Level Classification E-value
Superfamily Single hybrid motif 0.00314
Family Biotinyl/lipoyl-carrier proteins and domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256810420|ref|YP_003127789.1|
Sequence length 587
Comment V-type ATP synthase subunit A [Methanocaldococcus fervens AG86]
Sequence
MPVVGKIIKIAGPVVVAEGMKGAQMYEVVKVGEEKLTGEIIQLQDDKAVIQVYEETSGIK
PGEPVVGTGAPLSVELGPGMLRAMYDGIQRPLTAIEEKTGSIFIPRGVDVPALPRDIKWE
FKPTVSEGDYVEEGDIIGTVDETPSIVHKILVPVGVKGKIVEIKEGKFTVEETVAVVELE
NGERKELTMMQKWPVRKGRPYKEKLPPKIPMITGQRVEDTFFTLAKGGTAAIPGPFGSGK
TVTQHQLAKWSDADVVVYIGCGERGNEMTEVTEEFPHLEDIKTGNKLMDRTVLIANTSNM
PVAAREASVYTGITIAEYFRDMGYGVLLTADSTSRWAEAMREISGRLEEMPGEEGYPAYL
ASRLAQFYERAGRVICLGKDNREGFVSIVGAVSPPGGDFSEPVTSNTLRIVKVFWALDAN
LARRRHFPAINWLQSYSLYVDDVTDWWNANTGPDWRQLRDEAMGLLQKEAELQEIVQLVG
PDALPDRERVILEVARMLREDFLQQDAFDEVDTYCPPMKQYLMLKIIMNFYYEALKAVER
GVEPAKILKVSVKQDIARMKYIPHDEFINVKSKEIMEKIKNELGSLN
Download sequence
Identical sequences C7P6V7
573064.Mefer_0464 gi|256810420|ref|YP_003127789.1| WP_015791028.1.34365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]