SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256810524|ref|YP_003127893.1| from Methanocaldococcus fervens AG86

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256810524|ref|YP_003127893.1|
Domain Number 1 Region: 319-433
Classification Level Classification E-value
Superfamily Pseudouridine synthase 0.0000000000000245
Family Pseudouridine synthase II TruB 0.0053
Further Details:      
 
Weak hits

Sequence:  gi|256810524|ref|YP_003127893.1|
Domain Number - Region: 44-139
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00392
Family Rad50 coiled-coil Zn hook 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256810524|ref|YP_003127893.1|
Sequence length 441
Comment putative pseudouridylate synthase [Methanocaldococcus fervens AG86]
Sequence
MEIINYEILKKYPLCDRCFGRLYAKLLHTTNTERGRALKLYKALELEARIKKAKEKEIDY
KDELELLKALAKSGVDEIRLEEANAEKESCPWCRGIFSKQKMEKLLNKAIELLKEYDFET
FLVGTHLPEEIKELEKEIETEFMESIKQEFGREFGKVLAVRLDKAPNKEYPDIVVHINPY
TEEIYLQVNPLFIKGRYRKLIRGIPQTRWPCRKCRGKGCELCNYTGKKYPISVEEIIAKP
FLEATKGKDAKFHGAGREDIDVRMLGDGRPFVLEIKEPKIRKIDLDKIAEEINKDGRVEV
LNLEFGVRKDKVIFKNTPHRKTYRALVECSEKITDDDLKLLEKELENRTIYQKTPRRVLH
RRADLERIRKVYKVKTNKVDDNHFEMIIYCDGGLYIKELISGDDGRTNPSVSSILNKNCI
CKELDVLKIHDDEGENYGSNE
Download sequence
Identical sequences C7P761
gi|256810524|ref|YP_003127893.1| 573064.Mefer_0572 WP_015791130.1.34365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]