SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256810611|ref|YP_003127980.1| from Methanocaldococcus fervens AG86

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256810611|ref|YP_003127980.1|
Domain Number 1 Region: 1-51,793-999
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.48e-32
Family ABC transporter ATPase domain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 1-229
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.14e-30
Family ABC transporter ATPase domain-like 0.00033
Further Details:      
 
Domain Number 3 Region: 456-553
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 1.1e-17
Family Rad50 coiled-coil Zn hook 0.00045
Further Details:      
 
Domain Number 4 Region: 285-363
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0000288
Family Occludin/ELL domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256810611|ref|YP_003127980.1|
Sequence length 1007
Comment SMC domain-containing protein [Methanocaldococcus fervens AG86]
Sequence
MIINSITINNFKSHVNTKITFNDGIIAIIGENGSGKSSIFEAMFFALFGADALRRMGLTY
DEIITKGKKAMSVELDFEVNGNSYKVVREYDGRSSAKLYKNNELYAKTVNEVNRAISEIL
GVDKDMFLNSIYIKQGEIANLLNLPPADRKEVIGKLLGIDDFEKCYQKMRDVINEYRNQL
KEVEVNLSYKEKFEKDLKEKENQLAEKEKELERIKANIDKIKTEYETAKKNFVEWKEKKS
LYEKLINKLEEREKALELEKNKLKNLKYDLDEVLKANEILKSHKGEYGEYKSLTNRIKEI
ERRLRDLQPAYEEYIKLSKTLENIEKDIKELKEFVDKSKYKDRLDELNEILESIKKRIEE
VEKTAELLGELEILSQKLNEIEKYKKIANECKKYYEEYLKLEEKINEYNKLNLEYTKLLQ
NKESIEENIKNLNCEIENIEKELNGINIEEIKKSLEEIEKKKEELSQLQKEKEELKQKIG
EINNEINRLKKILDELKDVEGKCPLCKTPIDENKKLDLINSHKSQLDNKYNELEEIKRKI
KEIENEIDKINNEIAKEKQFREIETKYYEKKKRLEDLTLKMNGLKKELIMIENKLSSYIV
NGKPINEILEEYKTKLNEIRDKYNEYISAKNYLDSVDEENLRRNFEDIKEKVKGWFKEKC
KEEIKKLRDEEKEITYLINKIEELKKKENEFKNVENKMLLKLGMYKEYLSLNEALNDCRK
RVEELENIYKICNSAEITLNNIKRKYGKEDIENYINNKILEVNEKIKDIKERIDYINQKL
NEINYSEEEFKKIEEEFEKKQEKLKNAEIEKGKIESEIKYLRDDIETLNLKLKELSDLEK
EKEKLIKFIDYLNKVRSVFGKDGFQKYLRKIYTPLIQKYLNEAFNEFDLPYSFVELTEDL
EIKLHSPTGVLTIDNLSGGEQIAVALSLRLAIANALIGNKVECIILDEPTVYLDENRRAK
LAEIFRKINSVPQMIIITHHRELEEVADTIVNVTKERGVSKVKINES
Download sequence
Identical sequences C7P7E8
WP_015791217.1.34365 573064.Mefer_0661 gi|256810611|ref|YP_003127980.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]