SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256811057|ref|YP_003128426.1| from Methanocaldococcus fervens AG86

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256811057|ref|YP_003128426.1|
Domain Number 1 Region: 104-224
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 2.3e-28
Family MJ1460-like 0.0061
Further Details:      
 
Weak hits

Sequence:  gi|256811057|ref|YP_003128426.1|
Domain Number - Region: 5-136
Classification Level Classification E-value
Superfamily An anticodon-binding domain of class I aminoacyl-tRNA synthetases 0.0115
Family C-terminal domain of class I lysyl-tRNA synthetase 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256811057|ref|YP_003128426.1|
Sequence length 229
Comment 4-vinyl reductase 4VR [Methanocaldococcus fervens AG86]
Sequence
MTNAMKLIEMLRIIDNRAKFMGIKLTMMKNLLEKYKDDRELLKEILKLTEGTKLHDLILE
AYPPLEGLKRELKEEEYKLKVTTEKEVKKEEKMEFCIFVDTPSIVAYIKEYLRKFYMGNN
IKKVFYDIGKDYALKLGLNTYDDMINFMSKEFGETIVEKSEPLVVIVKNNKESINCSASE
PICYLTAGFIAGCLENITERRYIVDVVEKKCQAVGDPYCLFIAEKSIRL
Download sequence
Identical sequences C7P8P4
WP_015791662.1.34365 573064.Mefer_1116 gi|256811057|ref|YP_003128426.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]