SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221369605|ref|YP_002520701.1| from Rhodobacter sphaeroides KD131

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221369605|ref|YP_002520701.1|
Domain Number 1 Region: 63-203
Classification Level Classification E-value
Superfamily CBS-domain pair 4.55e-30
Family CBS-domain pair 0.0034
Further Details:      
 
Domain Number 2 Region: 206-285
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 4.91e-17
Family CorC/HlyC domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221369605|ref|YP_002520701.1|
Sequence length 307
Comment CBS domain containing protein [Rhodobacter sphaeroides KD131]
Sequence
MAAQSAPDQTEDDQAEPGPKGLFGRLFSAFSPAEAGGGALSPQDRAFAIAQSSLTLPGIA
NLRRLRVDDVAIPKVEIVAVPVDIGKEDLVAVFREHGFSRLPVYRETLDQPLGLVLLKDL
ALQHGFNGNGSFDLKTLLRPLLYAPPSMPIGVLLQKMQRERVHMALVIDEYGGVDGLVTI
EDLIETVIGEIEDEHDEVEGPLWTLEKPGVYMAQSRTPLDEFEAEIGLRLRREEEDEEID
TLGGLVFLRTGRVPVRGEIVPHESGAEFEVIDADARKIKRLRVRLPGAVTAPVGARALPA
EQPLHSG
Download sequence
Identical sequences B9KUA0
557760.RSKD131_3768 gi|221369605|ref|YP_002520701.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]