SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221640789|ref|YP_002527051.1| from Rhodobacter sphaeroides KD131

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221640789|ref|YP_002527051.1|
Domain Number 1 Region: 38-406
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.46e-60
Family L-arabinose binding protein-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221640789|ref|YP_002527051.1|
Sequence length 426
Comment branched-chain amino acid ABC transporter substrate-binding protein [Rhodobacter sphaeroides KD131]
Sequence
MNRETILHPTRRSLLAGGAAALTAATLPRFVQAQSSEPIRLGFQLHRTGIGAAYGRWYER
TALAALKVVNEAGGIAGRPVEILFEDDATDPRRGAEVVEKLASQAKVDMIFGPLFSHVVI
AAAPRAAELKIPYLVCSEGYHVASGKLNRWTLQPGITDVRAQVTAMAPWVTQNLGKKVTM
IFPDYAFGHDHRDFFTEAVKAQGGEVVAQIAIPPTETSFTRYFPRIPRDTEVLYHVMVGP
AVLTFVKELGEFYGSGAKPEIFGFIDSLEAVDIANPGLQFLEGSHFWEGQCRMLQPDASE
AETFYRDAVGVDANGAAIEDPKNVSCYGHMFSVWETLFAIKQGMEACSWRGPQDRQAFVE
AVEAFTEMPAGRERPQGAKVFNPKLHQVFGHQFISKLEGGKLVKVHETSLEDGIYPSDVD
YLATSF
Download sequence
Identical sequences B9KQ15
WP_015921595.1.19875 557760.RSKD131_2690 gi|221640789|ref|YP_002527051.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]