SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257051681|ref|YP_003129514.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257051681|ref|YP_003129514.1|
Domain Number 1 Region: 223-447
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000000000000111
Family Galactose oxidase, central domain 0.02
Further Details:      
 
Domain Number 2 Region: 82-302
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0000000000126
Family Galactose oxidase, central domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257051681|ref|YP_003129514.1|
Sequence length 466
Comment PKD domain-containing protein [Halorhabdus utahensis DSM 12940]
Sequence
MTDRRRFLSLCSIAGTGVLAACISNREGKETQSRDLPTNFSETAIKSPTESPTPTTSLTE
TNEVKTQAAKVYPTDGDSGDWFGRSVAMSSEGATAIITTLFEEGTNGDGAGSAYIFETSG
ESWDQQARLTPDDGNSEDWFGRSVAMSSDGTTTIIGATGDEDPNGDLAGSAYVFEDNDNS
WGQQAKLTPGDGDREDFFGVSAAVSSDGTSAIIGAHRDKNSNGEEAGSAYVFQDRNGSWS
QQAKLTPVDGDSGNRFGMSVAMSSDGTRAIIGAQNHDPSDGEIAGSAYVFKADDGSWSQQ
AKLTPDDGESNDGFGSAAAVSGDATTAIISAHRDKNSNGEEAGSAYVFQDRNGSWSQQAK
LTPDDGDSTDWFGSPVTLSSSGATAIIGASQDEDPNGEQAGSAYIFEANGGSWSQQAKLA
SADGDSGDRFGVSMAVSDDATTALIGAPHDEDPNGKRAGSAYVFTL
Download sequence
Identical sequences C7NSX0
519442.Huta_0594 gi|257051681|ref|YP_003129514.1| WP_015788362.1.40337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]