SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257052431|ref|YP_003130264.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257052431|ref|YP_003130264.1|
Domain Number 1 Region: 3-63
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.9e-16
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.0084
Further Details:      
 
Domain Number 2 Region: 63-140
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.00000000509
Family Lrp/AsnC-like transcriptional regulator C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257052431|ref|YP_003130264.1|
Sequence length 152
Comment transcriptional regulator, AsnC family [Halorhabdus utahensis DSM 12940]
Sequence
MDLDDIDRALVAALLEDGRASTQALAAGVGISPTAVERRIEALEDAGVIEGYAASVDYDA
LGYDVTAVVRVRTGTGPELVIETLGEYPWARSVYEVTGEDDVVLVGRFRDTDDMHENVAK
LLTESAVRSVTVDVVLDTVRACEPISVDTSAE
Download sequence
Identical sequences C7NND1
WP_015789105.1.40337 gi|257052431|ref|YP_003130264.1| 519442.Huta_1355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]