SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257053097|ref|YP_003130930.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257053097|ref|YP_003130930.1|
Domain Number 1 Region: 11-212
Classification Level Classification E-value
Superfamily YrdC/RibB 3.43e-75
Family 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB 0.00000179
Further Details:      
 
Domain Number 2 Region: 216-378
Classification Level Classification E-value
Superfamily RibA-like 1.14e-52
Family RibA-like 0.0000051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257053097|ref|YP_003130930.1|
Sequence length 412
Comment GTP cyclohydrolase II [Halorhabdus utahensis DSM 12940]
Sequence
MTVIESDRDRSRFDDIETAIDAIEDGEMILLVDEQSREDEGDLYVPAEAITPEQMNFMLK
HGRGLVCAPVSPEITDDLGLEQMVPASENTEEMSTRFTVSVDAASTGTGISAYDRAETVQ
ALVDPETEPADLDKPGHIFPLEAKADGVLDREGHTEAAVDLARIAGYRPGGVICEVVDDD
GTMAREDRLLEFADEHELPIVTVADVLEYRHLTETLVSREVDTRLPTAFGTFDMYGYDYR
GETHVALVNLDDVDPETDRPLVRIHSKCLTGDALHSLKCDCGFQLEETMQRISDEGGVLL
YLDQEGRGIGLLNKLKAYELQEHGYDTVEANVELGFEPDERRFDAAAQMLRDIGLDRVRL
LTNNPRKAAALERFEFDVEIDSLEIEPNPENEAYLATKAEKLDHQLDVFNSD
Download sequence
Identical sequences C7NTK7
519442.Huta_2029 gi|257053097|ref|YP_003130930.1| WP_015789768.1.40337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]