SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257053690|ref|YP_003131523.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257053690|ref|YP_003131523.1|
Domain Number 1 Region: 26-342
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.15e-105
Family Adenylation domain of NAD+-dependent DNA ligase 0.000000283
Further Details:      
 
Domain Number 2 Region: 427-600
Classification Level Classification E-value
Superfamily RuvA domain 2-like 1.93e-51
Family NAD+-dependent DNA ligase, domain 3 0.00012
Further Details:      
 
Domain Number 3 Region: 345-419
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.34e-23
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00069
Further Details:      
 
Domain Number 4 Region: 612-687
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000000028
Family DNA ligase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257053690|ref|YP_003131523.1|
Sequence length 693
Comment NAD-dependent DNA ligase LigA [Halorhabdus utahensis DSM 12940]
Sequence
MTAVEPPDNPYVENPPTDFESVDALDAESAHEQAEQLREAIRYHDHQYYVENDPVIGDRT
YDALFARLQDLEDGFGLDRENSPTQRVGGEPLDKLASVEHVAPMQSIDQGGEVTEVREFD
ERVARGMGDAGFDPDERTYFCEPKFDGLSVEIVYEDGVYQRAATRGDGEVGEDVTENVRT
IPSVPGRLRGDYPDTLAVRGEVYIPTDAFQAYNRERIERGDDPFANPRNAAAGTLRQLDP
SITAERPLAIFFFGVLDASVEFEQNSEVYERLPEWGLRVTDLAEEVDSIEDAIDYRDRLL
DERDDLPFEIDGVVIKLNDRAACDALGSTARAPRWAFAYKFPARTERTTIRDVVVQVGRT
GRLTPVALMDPVEVGGVMVSRASLHNPAEIERLGVDVGDEVRVQRAGDVIPEVAEVLDAA
SDGTFDFPESCPVCDSPVERDGPLAFCTGGLACPAQLERAIVHYASRAGLDIEGLGEERV
QQLLDAGLVEELADLYELGQLDLTSLEGWGMQSVANLQEELEASREPPLDDFLAALNVPS
LGAATATALAREFGTFEAVMDADREQLQAVDDIGPKVAAEIREFFETERNREAIERLLDH
VDPQPYEVEGGDELDGLTFVFTGTLSNYTRSEAQELVEVHGGSATSSVSGNTDYLVVGEN
PGQRKRDDADANDVQILDEDEFEELLAGRGVLD
Download sequence
Identical sequences C7NMK5
WP_015790352.1.40337 519442.Huta_2628 gi|257053690|ref|YP_003131523.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]