SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257053884|ref|YP_003131717.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257053884|ref|YP_003131717.1|
Domain Number 1 Region: 47-194,230-344
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0000000000032
Family Galactose oxidase, central domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257053884|ref|YP_003131717.1|
Sequence length 444
Comment quinoprotein (ISS) [Halorhabdus utahensis DSM 12940]
Sequence
MDLHRRDALRLVGAAGVTGLAGCGSIAAPGGGKSWSQRATLTAEDGTSGDQFGDSIAVSN
DGSTIIVGAPAATAAGVESGVVSVFERAGDSWSRTATLTPTDTAEFSGFGTSVALSGDGK
TAVIGCTGDERTDGLVSGAAYVFERSDDGWTQDARLSVDTAFTPAQGQYFDAFGAAVAIA
DDGKTALVGAPQYVDGSDDTAGTASLPGGSTTADVVAAPRSTLARVPGAAFAFERSDGEW
SREATVRPEDPDGRVGLGSSVALADRGSTAVICANGRNTVSVFTRAGGSWTETTTLPLAD
GVAVPLDEAIGVSNDGSRVIVGNSPGDDTGGSAIVFDRADGSWSRSELSLDHTQKFGPSV
AMAGDGETAIIPGLTDSDSNAVGVHVFTHAVGSWTAKTALTAESSRRGSRYGDALALSGD
GTTAVVGAPGGDTTAGSGTVYVFD
Download sequence
Identical sequences C7NR71
WP_015790546.1.40337 519442.Huta_2823 gi|257053884|ref|YP_003131717.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]