SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257054079|ref|YP_003131912.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257054079|ref|YP_003131912.1|
Domain Number 1 Region: 5-184
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.73e-49
Family GHMP Kinase, N-terminal domain 0.00000567
Further Details:      
 
Domain Number 2 Region: 186-354
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.55e-39
Family Galactokinase 0.0000404
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257054079|ref|YP_003131912.1|
Sequence length 361
Comment galactokinase [Halorhabdus utahensis DSM 12940]
Sequence
MVDFEGDYTVRSPGRVNLIGGHTDYTLGYVMPLATDLQTRLEATESEDVHVSSTAVESSY
SFATDDLEPVEDWVDYVKGCYAILQAAGYDPGGFRGDITTKLPIGAGLSSSASLELAVMA
LLNEAYDLGLSRERMARLSQRVENDYVGVACGIMDQFAVALGQDGHALSIDTETLTYTPV
PFPDGIEILVFHTGVSRGLVESAYNQRRETVEGALEKLDVDSSKDVSEGDLHGLDPLERE
RLGYVVRENARVQRAQAALEDGEIQTFGEILLSAHRDIADHYDASCKELDFVVETALEAG
AYGARLTGAGWGGAAIAVVDTETVESVATSIEAAYREQFPEHDPHYYRIEAADGVRVTHT
G
Download sequence
Identical sequences C7NSP3
gi|257054079|ref|YP_003131912.1| WP_015790741.1.40337 519442.Huta_3018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]