SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257051422|ref|YP_003129255.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257051422|ref|YP_003129255.1|
Domain Number 1 Region: 9-75
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000828
Family MarR-like transcriptional regulators 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257051422|ref|YP_003129255.1|
Sequence length 90
Comment ArsR family transcriptional regulator [Halorhabdus utahensis DSM 12940]
Sequence
MAEPDEEDITDLPPSAKLVFKVLEYKGPLTQKGIVEESMLSARTVRYALERLEEVDVVSE
DVYFADARQNLYELTTGDDATEKQDQAVSD
Download sequence
Identical sequences C7NQR3
519442.Huta_0335 WP_012795399.1.40337 gi|257051422|ref|YP_003129255.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]