SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257051468|ref|YP_003129301.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257051468|ref|YP_003129301.1|
Domain Number 1 Region: 7-125
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000103
Family Iron-dependent repressor protein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257051468|ref|YP_003129301.1|
Sequence length 143
Comment iron (metal) dependent repressor, DtxR family [Halorhabdus utahensis DSM 12940]
Sequence
MNTAEQYLKAIYLVQKQEDGPAPTGRIAERLGVSPASANEMVGKLEDRDLLEHEKYTGVT
LTDDGIARARDALQTYCIIERFLVQVLDVKDFRGEAKQLESVIDETVAERLDTIIDRPGE
CPDCFDADGDVCGRLDVEAEASD
Download sequence
Identical sequences C7NRD1
519442.Huta_0381 gi|257051468|ref|YP_003129301.1| WP_012795445.1.40337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]