SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257051767|ref|YP_003129600.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257051767|ref|YP_003129600.1|
Domain Number 1 Region: 49-121
Classification Level Classification E-value
Superfamily CPE0013-like 3.27e-23
Family CPE0013-like 0.0022
Further Details:      
 
Domain Number 2 Region: 5-59
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.00000072
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257051767|ref|YP_003129600.1|
Sequence length 131
Comment hypothetical protein Huta_0681 [Halorhabdus utahensis DSM 12940]
Sequence
MSPETVEITCIACPVGCDVSIEVEGGEIQSIEGFTCPRGKEYAKEEYRNPTRILPTTARV
AGGVLPRVPVKSAEPMPKPELEAAMREIAAVEVQAPVELGDVIVENVCDTDVDIVATRDL
PAADEGPKAAD
Download sequence
Identical sequences C7NTE5
519442.Huta_0681 gi|257051767|ref|YP_003129600.1| WP_015788447.1.40337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]