SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257052160|ref|YP_003129993.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257052160|ref|YP_003129993.1|
Domain Number 1 Region: 24-82
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000148
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257052160|ref|YP_003129993.1|
Sequence length 101
Comment hypothetical protein Huta_1079 [Halorhabdus utahensis DSM 12940]
Sequence
MTDLRDEYPSGWRILTQHSSVGYMIDALMDAPEYHFSKSELADLAGVSRQSVHTHLPLLR
RLDIVRVVDDSSPEEYTLNSGDEFVRELHRLNGLVNAKLDA
Download sequence
Identical sequences C7NM52
WP_015788836.1.40337 gi|257052160|ref|YP_003129993.1| 519442.Huta_1079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]