SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257052243|ref|YP_003130076.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257052243|ref|YP_003130076.1|
Domain Number 1 Region: 22-159
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000192
Family DNA-binding protein Mj223 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257052243|ref|YP_003130076.1|
Sequence length 185
Comment transcription regulator [Halorhabdus utahensis DSM 12940]
Sequence
MMEDSDTDQPTAEGPPPDAVVEARETMIGAFERSAEIYGVKRSYGRLYGVLYFAEEPLSL
DTLAARSEYAKSTVSTAMSDLQRYHMVTRRSLPGEGKKAFYEAETDFWQIFRAFLNNEVR
REIETMTGALEAAIDSLEDVEDERAERDRRKLRELKQVYERSDRIVGLFNSQSMDRIVSA
LERLQ
Download sequence
Identical sequences C7NMN0
WP_015788918.1.40337 519442.Huta_1167 gi|257052243|ref|YP_003130076.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]