SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257052887|ref|YP_003130720.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257052887|ref|YP_003130720.1|
Domain Number 1 Region: 20-111
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000338
Family DNA-binding protein Mj223 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257052887|ref|YP_003130720.1|
Sequence length 133
Comment transcriptional regulator, TrmB [Halorhabdus utahensis DSM 12940]
Sequence
MMAQTFQEIVVTEATADRALERIFGLNTSEQAVYRALLAAAEPLSAEALAAELDCALATA
YRYLETLEEHKLITEVTTRTGTQQPAVYEAVGPDRVAERMENCLERAYQQFSAEIDSVVL
ADEGCPPLDFPTV
Download sequence
Identical sequences C7NRQ1
gi|257052887|ref|YP_003130720.1| 519442.Huta_1817 WP_015789559.1.40337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]