SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257052974|ref|YP_003130807.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257052974|ref|YP_003130807.1|
Domain Number 1 Region: 54-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000112
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257052974|ref|YP_003130807.1|
Sequence length 134
Comment hypothetical protein Huta_1905 [Halorhabdus utahensis DSM 12940]
Sequence
MTRNTLIVTVESISTVQQRTRNAFDQALAEDVSAEEAPQRLSFETTDQLAQVFTPRAIDL
LQAIAEGEPVSIREAARLVDRDIKQVSENLERLEEYGIVEFVDKGRAKQPIVHYDEIDIH
LPLREATDPNIAPA
Download sequence
Identical sequences C7NSZ9 F7PGS9
519442.Huta_1905 gi|257052974|ref|YP_003130807.1| gi|529078202|ref|YP_008377205.1| WP_008524527.1.19926 WP_008524527.1.30395 WP_008524527.1.40337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]