SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257053004|ref|YP_003130837.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257053004|ref|YP_003130837.1|
Domain Number 1 Region: 53-146
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000644
Family Penicillinase repressor 0.045
Further Details:      
 
Weak hits

Sequence:  gi|257053004|ref|YP_003130837.1|
Domain Number - Region: 8-34
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00534
Family Desulforedoxin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257053004|ref|YP_003130837.1|
Sequence length 172
Comment transcriptional regulator, TrmB [Halorhabdus utahensis DSM 12940]
Sequence
MSPPSDATLFECETCGNLGFGDGEISCCDGPMQPVEEEQVSVEEPSLDELLRTVFDMSET
ELDICLCVMEGGELTVPDLAEDVGYDRSVVARHLDHLVELGVIDKHRRLLEEGGQIYVYT
PNDADVVTRRLTGAFANWVQDATALIDSISREKVEAMVEVDTDTPQWKIYQK
Download sequence
Identical sequences C7NT29
WP_015789675.1.40337 gi|257053004|ref|YP_003130837.1| 519442.Huta_1935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]