SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257053092|ref|YP_003130925.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257053092|ref|YP_003130925.1|
Domain Number 1 Region: 36-105
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000997
Family Iron-dependent repressor protein 0.03
Further Details:      
 
Weak hits

Sequence:  gi|257053092|ref|YP_003130925.1|
Domain Number - Region: 82-148
Classification Level Classification E-value
Superfamily Iron-dependent repressor protein, dimerization domain 0.000157
Family Iron-dependent repressor protein, dimerization domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257053092|ref|YP_003130925.1|
Sequence length 159
Comment iron dependent repressor [Halorhabdus utahensis DSM 12940]
Sequence
MTQDRMDPTDVSLTALSRSVTRTGGKYLCGLLRCSLADREQVATGDLADRLNVSRASVTE
MVEKFGDGDLVDHEHYKGTTLTGKGEVLARHLLWRRCVTEQFFERELALDIDVETAYRIG
FEFPDAGLNRLAERIDHPCDRTCRATEPDECAQLTVGSA
Download sequence
Identical sequences C7NTK2
gi|257053092|ref|YP_003130925.1| WP_015789763.1.40337 519442.Huta_2024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]