SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257053722|ref|YP_003131555.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257053722|ref|YP_003131555.1|
Domain Number 1 Region: 3-93
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.12e-29
Family PF0610-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257053722|ref|YP_003131555.1|
Sequence length 93
Comment hypothetical protein Huta_2661 [Halorhabdus utahensis DSM 12940]
Sequence
MQRTTRERIADRLRGESLSATALAAAFELSTATVIEHVEHIARSLDDSDEQLLVAPPACE
DCGFDGFDDRLNEPSRCPECHSENLSPPIFRIE
Download sequence
Identical sequences C7NQ96
gi|257053722|ref|YP_003131555.1| WP_015790384.1.40337 519442.Huta_2661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]