SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257053730|ref|YP_003131563.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257053730|ref|YP_003131563.1|
Domain Number 1 Region: 28-87
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000177
Family TrmB-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257053730|ref|YP_003131563.1|
Sequence length 197
Comment transcriptional regulator, TrmB [Halorhabdus utahensis DSM 12940]
Sequence
MNYMSRTAGNSERAINGLLSVAQLLEEPRLARLYTFVLREGEVTIDDIGDALEMPRTTAY
SDTGTLVELGMLTRDETRKTHRYSAVPISLTATLDGDEHTVTPTLIEAVGRAPRDQDLDL
LLEKHGLGKLAAALTYAIPYADGAMSERVAARELDLQYAFAIAVLQALREVVLDMQSVDP
YFEAIPSAREQPPETDA
Download sequence
Identical sequences C7NQA4
519442.Huta_2669 WP_015790392.1.40337 gi|257053730|ref|YP_003131563.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]