SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257053967|ref|YP_003131800.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257053967|ref|YP_003131800.1|
Domain Number 1 Region: 19-90
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000684
Family MarR-like transcriptional regulators 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257053967|ref|YP_003131800.1|
Sequence length 92
Comment transcription regulator, ArsR like protein [Halorhabdus utahensis DSM 12940]
Sequence
MSTTIEDGSRTEIILTKGEFRERLRELPPSAKLIAKVLETDQPLSQGQLATESLLPDRTV
RYALNRLEDADLVSSRYSYRDARKQVYYLTTE
Download sequence
Identical sequences C7NRW2
gi|257053967|ref|YP_003131800.1| 519442.Huta_2906 WP_015790629.1.40337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]