SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257054002|ref|YP_003131835.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257054002|ref|YP_003131835.1|
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.05e-20
Family F93-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257054002|ref|YP_003131835.1|
Sequence length 91
Comment transcriptional regulator, PadR-like family [Halorhabdus utahensis DSM 12940]
Sequence
MYDLTGFQRDLLYVIAGEEEPHGLAIKEELEDYYEKEIHHGRLYPNLDTLVDKGLVEKGQ
RDRRTNYYSLTRRGRREIEARRDWEGQYVDL
Download sequence
Identical sequences C7NSI6
WP_015790664.1.40337 519442.Huta_2941 gi|257054002|ref|YP_003131835.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]