SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229584388|ref|YP_002842889.1| from Sulfolobus islandicus M.16.27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229584388|ref|YP_002842889.1|
Domain Number 1 Region: 3-302
Classification Level Classification E-value
Superfamily FMN-binding split barrel 3.65e-77
Family UbiD middle domain-like 0.0001
Further Details:      
 
Domain Number 2 Region: 309-475
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 8.5e-38
Family UbiD C-terminal domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229584388|ref|YP_002842889.1|
Sequence length 478
Comment UbiD family decarboxylase [Sulfolobus islandicus M.16.27]
Sequence
MEIRRFIEEVEKLNLLREVKGAHWNLEIGAITDLNAKRNKYTLLFDEIVDYPKGFRVLTG
TLLDSRRVGLALGLTSNLNDLQLVTKLRERLNYANREYKSYDPIEVSDTPFLENVYGGEN
VNLFKFPAPKWHELDGGRYIGTADAVITKDPDSDWINVGAYRVMLVDKNKLAIFIEASHH
GRLHIEKYLKQARKAPIAISFGPPLSLFIFAGMEVPYGVSEYNFAGAVVGERMKVFRGEV
TGLPIPAESEIAIEGYITGEVTDEGPFGEFMGYYAGGRMKSPVIEVKRVYYRKDPILLGT
APSISPYDYSYLRCPIRSAMIWDFLERAGVPNVKGVWAHEVGFSRAFIVISIKQTFAGHA
TTVGHLVATSPLASYGGRYVIVVDEDIDPSDLNQVIWAMCTRSDPATTIDVIKNVNSTPL
DPMAERRENVKEYVSSRAIIYAVKPFDKLIRNQFPTEVRPSEELVEKITKKFNHLFSP
Download sequence
Identical sequences C3N4B9
427318.M1627_0912 gi|229584388|ref|YP_002842889.1| WP_012718656.1.27461 WP_012718656.1.74483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]