SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387761098|ref|YP_006068075.1| from Streptococcus salivarius 57.I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387761098|ref|YP_006068075.1|
Domain Number 1 Region: 210-401
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.92e-68
Family B3/B4 domain of PheRS, PheT 0.00000988
Further Details:      
 
Domain Number 2 Region: 473-694
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.52e-49
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00026
Further Details:      
 
Domain Number 3 Region: 36-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.14e-43
Family Myf domain 0.0034
Further Details:      
 
Domain Number 4 Region: 705-802
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 8.63e-30
Family Anticodon-binding domain of PheRS 0.00078
Further Details:      
 
Domain Number 5 Region: 409-481
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.28e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387761098|ref|YP_006068075.1|
Sequence length 802
Comment phenylalanyl-tRNA synthetase subunit beta [Streptococcus salivarius 57.I]
Sequence
MLVSYKWLKELVDVDVTTAELAEKMSTTGIEVEGVETPAEGLSKLVVGHVLSCEDVPDTH
LHLCQVDTGDAEGPRQIVCGAPNVTAGIKVIVAIPGARIADNYKIKKGKIRGMESLGMIC
SLAELGLPDSIIPKEFADGIQILPEDAVPGDSIFPYLDLDDEIIELSITPNRADALSMRG
VAHEVAAIYGKSVHFPEKTVTEDSKPASDKISVAIESDKVATYASRVVENVTVQPSPQWL
QNLLMNAGIRPINNVVDVTNYVLLYFGQPMHAFDLDKFEDSRIVARDARDGEKLVTLDGE
ERELTAEDIVITVADKPVALAGVMGGASTEIDNNSKNVVLEAAVFDGKSVRKTSSRLNLR
SESSSRFEKGINNDTVLEALDFAAAMLQELANGTVLAGRVQAGSVDTEPVQVSTSLDYVN
VRLGTELTFADIEDVFAKLGFGLTGDADKFTVSVPRRRWDISIQADLVEEIARIYGYEKL
PTTLPEAAGTAGELTETQALRRKVRTIAEGAGLTEIISYALTTPEKAVEFAVTPTNLTEL
MWPMTVDRSALRQNMVSGMLDTVAYNVNRKNSNVAIYEIGKVFEQNGNPKEELPNEINTF
AFAISGLVAEKDFQTKATPVDFFYAKGIVEALFDKLEVSVDYVPTKDLASMHPGRTAAIV
LDGQTIGFLGQVHPQTAKNYGIPETYVAEINLSAVEAALQPAQPFVEITKFPAVSRDIAL
LLKAEITHQEVLDAIYSAGVKRLVAVKLFDVYAGEKLGAGMKSMAYSLTFQNPNDNLTDE
EVAKYMEKITKALTEKVEAEVR
Download sequence
Identical sequences A0A0Y1XCM0 A0A1F1N5S5 F8HCK0
gi|387761098|ref|YP_006068075.1| WP_014633011.1.10057 WP_014633011.1.12892 WP_014633011.1.57908 WP_014633011.1.60752 WP_014633011.1.72526 WP_014633011.1.77705 WP_014633011.1.91148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]