SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387762247|ref|YP_006069224.1| from Streptococcus salivarius 57.I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387762247|ref|YP_006069224.1|
Domain Number 1 Region: 8-222
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.4e-52
Family PP-loop ATPase 0.00056
Further Details:      
 
Domain Number 2 Region: 340-392
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000863
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387762247|ref|YP_006069224.1|
Sequence length 421
Comment tRNA(Ile)-lysidine synthase [Streptococcus salivarius 57.I]
Sequence
MTQKLLQMMQAKGYFNQHKKILVAVSGGADSMSLLHFLYNHQKDLDIQLGIAHVNHKQRQ
ESEHEEAYLRHWAEEHKVPFHYSAFSGKFSENAARTFRYEFFKRVMKDYDYSALVTAHHA
DDQAETIFMRLLRGSRLRHLTGISAIRPFGTGQIIRPFLHLTKDQLPVTFHFEDRSNTSL
AYLRNRIRLSYLPTLSQENPKFKEHLCLLAEEIGLMKQALEELTKDITITDLSVFQQQSD
AVQLFLLQNYLDTFPDLQLSKGQFNQLISYLRKNVSGKIPLKNGYELVKTQTSFLIRKEE
AISLSPPCLLEFGKSVEFEDYTLTFSEFNDVSNADTISIWSDSPIVIRHRKEGDKIDLGS
HHKKLRRLFIDNKILEKDRQKAIIGEQDDQIIFLYVAGRLYLKKRPENAILYGTVVIYKN
F
Download sequence
Identical sequences F8HCK6
gi|387762247|ref|YP_006069224.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]