SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229608035|ref|YP_002878683.1| from Vibrio cholerae MJ-1236

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229608035|ref|YP_002878683.1|
Domain Number 1 Region: 191-468
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 7.85e-78
Family Cryptochrome/photolyase FAD-binding domain 0.0000618
Further Details:      
 
Domain Number 2 Region: 3-194
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 3.79e-41
Family Cryptochrome/photolyase, N-terminal domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229608035|ref|YP_002878683.1|
Sequence length 504
Comment deoxyribodipyrimidine photolyase/cryptochrome family protein [Vibrio cholerae MJ-1236]
Sequence
MEKINLVWLKRDLRLTDHAPLQAALTSGRPTLLLYLFEPMLLGDAHYSERHWRFVWQSLQ
AINRDLAQSKGEVLIVTSDWQTCFARIAERYAIEAIYSHQEVGLACTFQRDLALAQWCQQ
HDIVWHEFPYAAVIRGAQTRKNWDEHWQQVMRSPCCDPDLTRANWLKLDAATLGLRSDIP
ATWQSKQAGMQTGGSDMAWATLEDFFARRGREYYRSISSPSLARHACSRMSPYLAWGNIS
LREMYQTLLKHWSVAGFRRSLIALSSRLHWHCHFIQKFESECEMEFRCVNRAYDSLLQQS
SDAPAAQLAAWQTGHTGIPLVDACMRCLIQTGYLNFRMRAMLVSVLTHHMNVDWRAGVTY
LAQLFLDFEPGIHYPQFQMQAGVTGTNTIRIYNPTKQAQEHDSEGQFIHKWVPELAQVPV
PLLFEPWLMTPLEAQMYQVPLESPYLKPVMDLEASAKQARDRLWQWQKLPAVQAEAMRIL
ARHVRQAKPRTSPRQPNKRQPEMD
Download sequence
Identical sequences A0A0H3Q1R5 A0A0H5U8Y4 A0A0K9V0H4 A0A0X1KWI6 C3LM87 Q9KS67
gi|360035287|ref|YP_004937050.1| gi|229608035|ref|YP_002878683.1| NP_231036.1.72393 WP_000411504.1.100264 WP_000411504.1.100388 WP_000411504.1.100440 WP_000411504.1.10071 WP_000411504.1.100976 WP_000411504.1.101117 WP_000411504.1.10121 WP_000411504.1.101220 WP_000411504.1.101314 WP_000411504.1.101507 WP_000411504.1.101933 WP_000411504.1.102054 WP_000411504.1.1024 WP_000411504.1.10626 WP_000411504.1.10834 WP_000411504.1.11270 WP_000411504.1.11351 WP_000411504.1.11879 WP_000411504.1.11885 WP_000411504.1.11965 WP_000411504.1.12252 WP_000411504.1.12262 WP_000411504.1.12332 WP_000411504.1.12525 WP_000411504.1.12527 WP_000411504.1.12548 WP_000411504.1.12590 WP_000411504.1.12686 WP_000411504.1.13053 WP_000411504.1.13155 WP_000411504.1.13156 WP_000411504.1.13454 WP_000411504.1.13652 WP_000411504.1.13725 WP_000411504.1.14080 WP_000411504.1.14263 WP_000411504.1.14904 WP_000411504.1.14995 WP_000411504.1.15109 WP_000411504.1.15200 WP_000411504.1.15516 WP_000411504.1.15786 WP_000411504.1.15997 WP_000411504.1.16351 WP_000411504.1.16382 WP_000411504.1.17232 WP_000411504.1.17295 WP_000411504.1.17621 WP_000411504.1.18375 WP_000411504.1.18447 WP_000411504.1.18577 WP_000411504.1.18862 WP_000411504.1.18916 WP_000411504.1.19126 WP_000411504.1.19128 WP_000411504.1.19442 WP_000411504.1.19503 WP_000411504.1.19597 WP_000411504.1.20065 WP_000411504.1.20107 WP_000411504.1.20379 WP_000411504.1.20404 WP_000411504.1.20602 WP_000411504.1.20669 WP_000411504.1.20699 WP_000411504.1.20758 WP_000411504.1.21073 WP_000411504.1.21281 WP_000411504.1.21558 WP_000411504.1.21671 WP_000411504.1.21717 WP_000411504.1.21764 WP_000411504.1.21815 WP_000411504.1.21866 WP_000411504.1.22521 WP_000411504.1.22773 WP_000411504.1.229 WP_000411504.1.22953 WP_000411504.1.2304 WP_000411504.1.23333 WP_000411504.1.2341 WP_000411504.1.23416 WP_000411504.1.23424 WP_000411504.1.23538 WP_000411504.1.2354 WP_000411504.1.23808 WP_000411504.1.23955 WP_000411504.1.240 WP_000411504.1.2401 WP_000411504.1.24106 WP_000411504.1.24280 WP_000411504.1.24345 WP_000411504.1.24399 WP_000411504.1.2496 WP_000411504.1.24980 WP_000411504.1.26020 WP_000411504.1.26156 WP_000411504.1.2627 WP_000411504.1.26326 WP_000411504.1.26508 WP_000411504.1.26580 WP_000411504.1.27186 WP_000411504.1.27435 WP_000411504.1.27458 WP_000411504.1.27639 WP_000411504.1.27863 WP_000411504.1.28431 WP_000411504.1.2849 WP_000411504.1.29095 WP_000411504.1.29535 WP_000411504.1.29708 WP_000411504.1.29889 WP_000411504.1.30107 WP_000411504.1.30292 WP_000411504.1.3032 WP_000411504.1.30360 WP_000411504.1.3054 WP_000411504.1.30927 WP_000411504.1.31718 WP_000411504.1.32264 WP_000411504.1.32271 WP_000411504.1.32814 WP_000411504.1.32955 WP_000411504.1.33019 WP_000411504.1.33093 WP_000411504.1.33811 WP_000411504.1.33819 WP_000411504.1.34108 WP_000411504.1.34195 WP_000411504.1.34634 WP_000411504.1.3514 WP_000411504.1.35201 WP_000411504.1.35266 WP_000411504.1.35630 WP_000411504.1.35880 WP_000411504.1.35881 WP_000411504.1.3635 WP_000411504.1.36354 WP_000411504.1.36441 WP_000411504.1.36513 WP_000411504.1.36668 WP_000411504.1.36686 WP_000411504.1.36973 WP_000411504.1.37054 WP_000411504.1.37260 WP_000411504.1.37262 WP_000411504.1.37537 WP_000411504.1.37676 WP_000411504.1.37784 WP_000411504.1.37999 WP_000411504.1.38420 WP_000411504.1.38590 WP_000411504.1.39514 WP_000411504.1.39853 WP_000411504.1.39933 WP_000411504.1.40039 WP_000411504.1.40152 WP_000411504.1.40433 WP_000411504.1.40459 WP_000411504.1.40470 WP_000411504.1.40484 WP_000411504.1.40491 WP_000411504.1.40542 WP_000411504.1.40740 WP_000411504.1.41573 WP_000411504.1.4175 WP_000411504.1.42128 WP_000411504.1.42152 WP_000411504.1.42498 WP_000411504.1.42617 WP_000411504.1.4272 WP_000411504.1.4284 WP_000411504.1.42853 WP_000411504.1.42865 WP_000411504.1.42885 WP_000411504.1.43335 WP_000411504.1.4365 WP_000411504.1.43884 WP_000411504.1.439 WP_000411504.1.44569 WP_000411504.1.44709 WP_000411504.1.44730 WP_000411504.1.45055 WP_000411504.1.45127 WP_000411504.1.45155 WP_000411504.1.45206 WP_000411504.1.45264 WP_000411504.1.45372 WP_000411504.1.45704 WP_000411504.1.45842 WP_000411504.1.45903 WP_000411504.1.45958 WP_000411504.1.46118 WP_000411504.1.46146 WP_000411504.1.4661 WP_000411504.1.4701 WP_000411504.1.47202 WP_000411504.1.4730 WP_000411504.1.4731 WP_000411504.1.47417 WP_000411504.1.47428 WP_000411504.1.47796 WP_000411504.1.47846 WP_000411504.1.47942 WP_000411504.1.48128 WP_000411504.1.48715 WP_000411504.1.488 WP_000411504.1.48927 WP_000411504.1.49238 WP_000411504.1.49317 WP_000411504.1.50277 WP_000411504.1.50577 WP_000411504.1.50625 WP_000411504.1.50813 WP_000411504.1.50822 WP_000411504.1.50980 WP_000411504.1.51160 WP_000411504.1.51177 WP_000411504.1.51661 WP_000411504.1.5201 WP_000411504.1.52391 WP_000411504.1.5320 WP_000411504.1.53214 WP_000411504.1.5397 WP_000411504.1.54191 WP_000411504.1.5425 WP_000411504.1.54398 WP_000411504.1.5450 WP_000411504.1.54901 WP_000411504.1.55092 WP_000411504.1.55665 WP_000411504.1.55929 WP_000411504.1.55932 WP_000411504.1.56429 WP_000411504.1.56785 WP_000411504.1.57148 WP_000411504.1.57300 WP_000411504.1.57518 WP_000411504.1.57546 WP_000411504.1.57678 WP_000411504.1.57945 WP_000411504.1.58295 WP_000411504.1.58596 WP_000411504.1.58844 WP_000411504.1.58975 WP_000411504.1.59010 WP_000411504.1.59194 WP_000411504.1.59378 WP_000411504.1.59394 WP_000411504.1.5943 WP_000411504.1.59554 WP_000411504.1.59633 WP_000411504.1.59741 WP_000411504.1.59916 WP_000411504.1.60386 WP_000411504.1.60633 WP_000411504.1.60694 WP_000411504.1.60955 WP_000411504.1.61169 WP_000411504.1.61523 WP_000411504.1.61624 WP_000411504.1.61644 WP_000411504.1.61753 WP_000411504.1.61869 WP_000411504.1.61875 WP_000411504.1.61935 WP_000411504.1.62165 WP_000411504.1.62324 WP_000411504.1.62425 WP_000411504.1.63347 WP_000411504.1.63546 WP_000411504.1.63655 WP_000411504.1.6366 WP_000411504.1.63723 WP_000411504.1.63749 WP_000411504.1.63779 WP_000411504.1.64201 WP_000411504.1.64253 WP_000411504.1.64315 WP_000411504.1.64382 WP_000411504.1.65007 WP_000411504.1.65051 WP_000411504.1.65086 WP_000411504.1.66329 WP_000411504.1.66633 WP_000411504.1.66696 WP_000411504.1.68424 WP_000411504.1.68506 WP_000411504.1.68723 WP_000411504.1.68863 WP_000411504.1.68925 WP_000411504.1.69049 WP_000411504.1.69843 WP_000411504.1.69857 WP_000411504.1.70069 WP_000411504.1.70176 WP_000411504.1.70247 WP_000411504.1.7049 WP_000411504.1.70813 WP_000411504.1.70892 WP_000411504.1.71129 WP_000411504.1.72241 WP_000411504.1.72326 WP_000411504.1.72361 WP_000411504.1.72369 WP_000411504.1.7238 WP_000411504.1.72480 WP_000411504.1.72856 WP_000411504.1.73148 WP_000411504.1.73429 WP_000411504.1.73555 WP_000411504.1.73855 WP_000411504.1.73929 WP_000411504.1.74111 WP_000411504.1.74503 WP_000411504.1.74666 WP_000411504.1.74991 WP_000411504.1.75012 WP_000411504.1.75326 WP_000411504.1.75378 WP_000411504.1.75778 WP_000411504.1.76425 WP_000411504.1.76486 WP_000411504.1.7654 WP_000411504.1.76645 WP_000411504.1.77029 WP_000411504.1.7717 WP_000411504.1.77355 WP_000411504.1.77397 WP_000411504.1.77445 WP_000411504.1.77703 WP_000411504.1.77794 WP_000411504.1.77830 WP_000411504.1.77914 WP_000411504.1.78157 WP_000411504.1.78531 WP_000411504.1.79044 WP_000411504.1.79776 WP_000411504.1.79943 WP_000411504.1.80024 WP_000411504.1.8023 WP_000411504.1.80339 WP_000411504.1.80618 WP_000411504.1.80628 WP_000411504.1.80702 WP_000411504.1.80744 WP_000411504.1.80808 WP_000411504.1.8117 WP_000411504.1.81871 WP_000411504.1.81917 WP_000411504.1.82119 WP_000411504.1.82193 WP_000411504.1.82248 WP_000411504.1.82262 WP_000411504.1.82413 WP_000411504.1.82583 WP_000411504.1.83040 WP_000411504.1.83073 WP_000411504.1.83082 WP_000411504.1.83109 WP_000411504.1.83703 WP_000411504.1.83761 WP_000411504.1.84385 WP_000411504.1.84519 WP_000411504.1.84610 WP_000411504.1.8480 WP_000411504.1.85007 WP_000411504.1.85086 WP_000411504.1.85498 WP_000411504.1.85822 WP_000411504.1.85878 WP_000411504.1.85961 WP_000411504.1.85972 WP_000411504.1.85998 WP_000411504.1.86057 WP_000411504.1.86192 WP_000411504.1.86269 WP_000411504.1.86879 WP_000411504.1.87274 WP_000411504.1.87286 WP_000411504.1.87335 WP_000411504.1.87355 WP_000411504.1.87573 WP_000411504.1.87602 WP_000411504.1.87804 WP_000411504.1.88057 WP_000411504.1.88230 WP_000411504.1.88283 WP_000411504.1.88350 WP_000411504.1.88556 WP_000411504.1.8867 WP_000411504.1.89144 WP_000411504.1.89441 WP_000411504.1.89447 WP_000411504.1.89822 WP_000411504.1.89889 WP_000411504.1.8997 WP_000411504.1.90120 WP_000411504.1.90133 WP_000411504.1.90227 WP_000411504.1.90437 WP_000411504.1.90675 WP_000411504.1.90774 WP_000411504.1.90889 WP_000411504.1.91247 WP_000411504.1.91262 WP_000411504.1.91274 WP_000411504.1.91539 WP_000411504.1.91747 WP_000411504.1.91794 WP_000411504.1.91841 WP_000411504.1.92038 WP_000411504.1.92063 WP_000411504.1.92069 WP_000411504.1.92157 WP_000411504.1.92401 WP_000411504.1.92516 WP_000411504.1.92559 WP_000411504.1.92696 WP_000411504.1.92703 WP_000411504.1.92952 WP_000411504.1.92993 WP_000411504.1.9302 WP_000411504.1.93060 WP_000411504.1.93399 WP_000411504.1.93836 WP_000411504.1.93945 WP_000411504.1.94255 WP_000411504.1.94426 WP_000411504.1.94441 WP_000411504.1.94887 WP_000411504.1.95516 WP_000411504.1.95549 WP_000411504.1.9561 WP_000411504.1.95662 WP_000411504.1.95733 WP_000411504.1.95976 WP_000411504.1.9607 WP_000411504.1.96089 WP_000411504.1.96311 WP_000411504.1.96471 WP_000411504.1.9660 WP_000411504.1.96687 WP_000411504.1.96704 WP_000411504.1.96980 WP_000411504.1.97100 WP_000411504.1.97144 WP_000411504.1.97516 WP_000411504.1.97552 WP_000411504.1.97650 WP_000411504.1.97799 WP_000411504.1.97832 WP_000411504.1.9787 WP_000411504.1.98021 WP_000411504.1.98116 WP_000411504.1.98172 WP_000411504.1.98246 WP_000411504.1.98280 WP_000411504.1.98624 WP_000411504.1.98642 WP_000411504.1.99128 WP_000411504.1.99204 WP_000411504.1.99417 WP_000411504.1.99452 WP_000411504.1.995 WP_000411504.1.99872 WP_000411504.1.99992 gi|15641404|ref|NP_231036.1| gi|379741188|ref|YP_005333157.1| 243277.VC1392 579112.VCM66_1347 593588.VCD_002953 gi|227081563|ref|YP_002810114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]