SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|224367633|ref|YP_002601796.1| from Desulfobacterium autotrophicum HRM2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|224367633|ref|YP_002601796.1|
Domain Number 1 Region: 16-367
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.18e-106
Family IF2B-like 0.0000007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|224367633|ref|YP_002601796.1|
Sequence length 382
Comment putative translation initiation factor eIF-2B alpha subunit [Desulfobacterium autotrophicum HRM2]
Sequence
MMTDKFQPMEEIKMLVDNQQMRPIWFDGEKKIARVIDQRMLPHKLVIADLNTVDDVIYAI
QEMFVRGAPLIGATGAFGVYTALLQNQTCTSEDLVRECNRLKSARPTAVNLAWGVDRVLE
ACLNVNVPADRLNAARNEALAIVEDEAENCRQIGLHGLSIIQEISRKKGGAPVNILTHCN
AGWLACIEYGTATAPMYTAFDQKIDIHVWVDETRPLNQGSRLTAWELGKHGINHTIITDN
AGGHLMQHGMVDLVIVGTDRTTRSGDVANKIGTYLKALAAKDNNLPFYVALPSSTIDWEI
DNGITDIPIEERDPEEIQYVQGLDQAGNLVKVLVPPLSSPAANHAFDVTPARLVTGLITE
RGICRATREDILALFPEKRATK
Download sequence
Identical sequences C0QHS4
177437.HRM2_05180 gi|224367633|ref|YP_002601796.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]