SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|224368032|ref|YP_002602195.1| from Desulfobacterium autotrophicum HRM2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|224368032|ref|YP_002602195.1|
Domain Number 1 Region: 232-273,306-334,427-629
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.09e-44
Family CoA transferase alpha subunit-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|224368032|ref|YP_002602195.1|
Sequence length 724
Comment putative acetyl-CoA hydrolase (acetyl-CoA hydrolase/transferase family protein) [Desulfobacterium autotrophicum HRM2]
Sequence
MSKKQPVYFTDVEQCVDDLIGQVGKEIILAAPLALAKPTQLINAIYRRLKTDPELHFTLV
TAVALEKPTWSSELEHRFLGPLVERIWGGFIDFDYVLDMRKGQIPPNFELVEFFNKAGGW
MTNAHAAQNYLGSNYTHAVRDAVINRCNVLSQLVAKQEINGKILFSMSSNPDTHLEGAKV
MRDMRAKGEKVAIIAQVNTNLPFMYGKAVVEPGFYDMVIDSPDLDFTLFGAPKEPINNVD
WMIGLHASTLVRDGGTIQVGIGSLGDAIVAGLDMRHRENKAYCDFLTQADILSKFNPLIQ
TIGGTDVFKTGLLGSSEMFVDSLLELIKAGIIKRKVYEDVRLQKLLNQKRFEDTQIEDIF
REFVAQRMLHPVIKESEVGFLKHFGIFHPDVTYVDRSIRLGQTEYSLDMRIAKNVEAVAL
NCLGPCLKNGVVLYASFFIGPQAFYTELREMDDDQLKLIDMRGVDYVNQLYGNEALKRLQ
RVHGRFINAGIMVTLSGAVCAGGLEDNKIISGPGGQYNFVAMAHALDDGRAVTMIRSTRE
AGSKTTSNVVWQYGHITIPRHLRDIVVTEYGIADLRGARDREAMTRLICIADSRFQEELL
DKAKAAGKIPRDWQIPEPFTNNTPQALEEKLAAFRKKGFFKSFPFGTDFTDEEIVLGRAL
RQFKQKAEENKFAIMPGLIGQGLSSIPKTARPYLERMGLEDPETMQEKLMQKIVLFALKS
SGAI
Download sequence
Identical sequences C0QKG0
WP_012663271.1.52472 gi|224368032|ref|YP_002602195.1| 177437.HRM2_09180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]