SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253755873|ref|YP_003029013.1| from Streptococcus suis BM407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253755873|ref|YP_003029013.1|
Domain Number 1 Region: 3-282
Classification Level Classification E-value
Superfamily DAK1/DegV-like 4.45e-67
Family DegV-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|253755873|ref|YP_003029013.1|
Sequence length 283
Comment hypothetical protein SSUBM407_1301 [Streptococcus suis BM407]
Sequence
MTKWKIVADSGCDYRQLANLAPDTEFISVPLTIQVGEQAFVDDASLDIDHMMEVMEASKS
AAGSACPSPQAYQAAFEGAENIIVVTITGGLSGSFNAARVARDMYIEEHPNVNIHLIDSL
SASGEMDLLVDEINRLISAGLDFPQVVEAITHYREHSKLLFVLAKVDNLVKNGRLSKLVG
TVVGLLNIRMVGEASAEGKLELLQKARGHKKSVTAAFEEMKKAGYDGGRIVMAHRNNAKF
FQQFSELVKASFPTAVIDEVATSGLCSFYAEEGGLLMGYEVKA
Download sequence
Identical sequences A0A0H3N0D8 D5AGQ0 G7SNV1 M3T1P2 U5UFM8
gi|556588994|ref|YP_008756548.1| gi|253751395|ref|YP_003024536.1| gi|146320409|ref|YP_001200120.1| gi|389856886|ref|YP_006359129.1| 218494.SSU0512 391296.SSU98_0561 568813.SSUSC84_0497 568814.SSUBM407_1301 gi|386587785|ref|YP_006084186.1| WP_002938910.1.10007 WP_002938910.1.100280 WP_002938910.1.100404 WP_002938910.1.100701 WP_002938910.1.100908 WP_002938910.1.101097 WP_002938910.1.101179 WP_002938910.1.101295 WP_002938910.1.101621 WP_002938910.1.101658 WP_002938910.1.101706 WP_002938910.1.102038 WP_002938910.1.10265 WP_002938910.1.1035 WP_002938910.1.10700 WP_002938910.1.10896 WP_002938910.1.11017 WP_002938910.1.11330 WP_002938910.1.11548 WP_002938910.1.11662 WP_002938910.1.11869 WP_002938910.1.11874 WP_002938910.1.1200 WP_002938910.1.12022 WP_002938910.1.12228 WP_002938910.1.12288 WP_002938910.1.1244 WP_002938910.1.12606 WP_002938910.1.12803 WP_002938910.1.13095 WP_002938910.1.1324 WP_002938910.1.13380 WP_002938910.1.13633 WP_002938910.1.1370 WP_002938910.1.13861 WP_002938910.1.1405 WP_002938910.1.14202 WP_002938910.1.14210 WP_002938910.1.1424 WP_002938910.1.1434 WP_002938910.1.14359 WP_002938910.1.1495 WP_002938910.1.15112 WP_002938910.1.1537 WP_002938910.1.15393 WP_002938910.1.15545 WP_002938910.1.15756 WP_002938910.1.15813 WP_002938910.1.16193 WP_002938910.1.1629 WP_002938910.1.16498 WP_002938910.1.16643 WP_002938910.1.16683 WP_002938910.1.16773 WP_002938910.1.16829 WP_002938910.1.16881 WP_002938910.1.17264 WP_002938910.1.17670 WP_002938910.1.17749 WP_002938910.1.17814 WP_002938910.1.17958 WP_002938910.1.17989 WP_002938910.1.18271 WP_002938910.1.18341 WP_002938910.1.18403 WP_002938910.1.18563 WP_002938910.1.18711 WP_002938910.1.19352 WP_002938910.1.19378 WP_002938910.1.1953 WP_002938910.1.19865 WP_002938910.1.19898 WP_002938910.1.20400 WP_002938910.1.20518 WP_002938910.1.20584 WP_002938910.1.20756 WP_002938910.1.20944 WP_002938910.1.20983 WP_002938910.1.21016 WP_002938910.1.21072 WP_002938910.1.21347 WP_002938910.1.21457 WP_002938910.1.21903 WP_002938910.1.22785 WP_002938910.1.22882 WP_002938910.1.23089 WP_002938910.1.23273 WP_002938910.1.23317 WP_002938910.1.23358 WP_002938910.1.23682 WP_002938910.1.23965 WP_002938910.1.24078 WP_002938910.1.24150 WP_002938910.1.24175 WP_002938910.1.24187 WP_002938910.1.24431 WP_002938910.1.24858 WP_002938910.1.24883 WP_002938910.1.25245 WP_002938910.1.25280 WP_002938910.1.25381 WP_002938910.1.25396 WP_002938910.1.25617 WP_002938910.1.25711 WP_002938910.1.25798 WP_002938910.1.25824 WP_002938910.1.25950 WP_002938910.1.26009 WP_002938910.1.26302 WP_002938910.1.26368 WP_002938910.1.26620 WP_002938910.1.27108 WP_002938910.1.27225 WP_002938910.1.27227 WP_002938910.1.27381 WP_002938910.1.27476 WP_002938910.1.27695 WP_002938910.1.27754 WP_002938910.1.27760 WP_002938910.1.27767 WP_002938910.1.28000 WP_002938910.1.28033 WP_002938910.1.28244 WP_002938910.1.28467 WP_002938910.1.28645 WP_002938910.1.28796 WP_002938910.1.28805 WP_002938910.1.29141 WP_002938910.1.29542 WP_002938910.1.29610 WP_002938910.1.29635 WP_002938910.1.30079 WP_002938910.1.30241 WP_002938910.1.30414 WP_002938910.1.30785 WP_002938910.1.31418 WP_002938910.1.31597 WP_002938910.1.31707 WP_002938910.1.31730 WP_002938910.1.31763 WP_002938910.1.32048 WP_002938910.1.32259 WP_002938910.1.32332 WP_002938910.1.32466 WP_002938910.1.32630 WP_002938910.1.32947 WP_002938910.1.33330 WP_002938910.1.33494 WP_002938910.1.34321 WP_002938910.1.34425 WP_002938910.1.34527 WP_002938910.1.34652 WP_002938910.1.34738 WP_002938910.1.35306 WP_002938910.1.35430 WP_002938910.1.35551 WP_002938910.1.35675 WP_002938910.1.35725 WP_002938910.1.36136 WP_002938910.1.36251 WP_002938910.1.36341 WP_002938910.1.36611 WP_002938910.1.36766 WP_002938910.1.36945 WP_002938910.1.37126 WP_002938910.1.37237 WP_002938910.1.376 WP_002938910.1.37653 WP_002938910.1.37688 WP_002938910.1.37816 WP_002938910.1.37841 WP_002938910.1.37915 WP_002938910.1.38409 WP_002938910.1.38470 WP_002938910.1.39011 WP_002938910.1.39023 WP_002938910.1.39247 WP_002938910.1.39280 WP_002938910.1.39714 WP_002938910.1.3989 WP_002938910.1.40062 WP_002938910.1.40141 WP_002938910.1.40228 WP_002938910.1.40384 WP_002938910.1.40507 WP_002938910.1.40669 WP_002938910.1.4074 WP_002938910.1.40802 WP_002938910.1.41046 WP_002938910.1.41112 WP_002938910.1.41280 WP_002938910.1.41340 WP_002938910.1.41854 WP_002938910.1.42323 WP_002938910.1.42552 WP_002938910.1.42596 WP_002938910.1.42732 WP_002938910.1.42784 WP_002938910.1.42827 WP_002938910.1.42840 WP_002938910.1.4291 WP_002938910.1.43264 WP_002938910.1.43288 WP_002938910.1.43482 WP_002938910.1.43813 WP_002938910.1.43922 WP_002938910.1.43963 WP_002938910.1.43977 WP_002938910.1.44047 WP_002938910.1.44128 WP_002938910.1.44592 WP_002938910.1.44676 WP_002938910.1.44778 WP_002938910.1.45088 WP_002938910.1.45216 WP_002938910.1.45219 WP_002938910.1.45278 WP_002938910.1.45345 WP_002938910.1.45864 WP_002938910.1.45936 WP_002938910.1.467 WP_002938910.1.46880 WP_002938910.1.47315 WP_002938910.1.47375 WP_002938910.1.47434 WP_002938910.1.4748 WP_002938910.1.4757 WP_002938910.1.47643 WP_002938910.1.47745 WP_002938910.1.47894 WP_002938910.1.47900 WP_002938910.1.48167 WP_002938910.1.48217 WP_002938910.1.48397 WP_002938910.1.48603 WP_002938910.1.49093 WP_002938910.1.49099 WP_002938910.1.49206 WP_002938910.1.49255 WP_002938910.1.49368 WP_002938910.1.49413 WP_002938910.1.49509 WP_002938910.1.49782 WP_002938910.1.49968 WP_002938910.1.50047 WP_002938910.1.5021 WP_002938910.1.50437 WP_002938910.1.50538 WP_002938910.1.50551 WP_002938910.1.50675 WP_002938910.1.50751 WP_002938910.1.5079 WP_002938910.1.50798 WP_002938910.1.51263 WP_002938910.1.51386 WP_002938910.1.51551 WP_002938910.1.52159 WP_002938910.1.52175 WP_002938910.1.52599 WP_002938910.1.52628 WP_002938910.1.52798 WP_002938910.1.53174 WP_002938910.1.53290 WP_002938910.1.53309 WP_002938910.1.534 WP_002938910.1.53448 WP_002938910.1.53487 WP_002938910.1.53749 WP_002938910.1.53805 WP_002938910.1.53918 WP_002938910.1.54000 WP_002938910.1.5404 WP_002938910.1.54184 WP_002938910.1.54384 WP_002938910.1.54488 WP_002938910.1.54535 WP_002938910.1.54683 WP_002938910.1.54800 WP_002938910.1.54828 WP_002938910.1.55064 WP_002938910.1.55137 WP_002938910.1.55158 WP_002938910.1.55649 WP_002938910.1.55687 WP_002938910.1.5579 WP_002938910.1.55815 WP_002938910.1.55833 WP_002938910.1.55834 WP_002938910.1.56140 WP_002938910.1.56215 WP_002938910.1.56434 WP_002938910.1.56463 WP_002938910.1.57067 WP_002938910.1.5714 WP_002938910.1.57164 WP_002938910.1.57189 WP_002938910.1.5754 WP_002938910.1.57640 WP_002938910.1.57674 WP_002938910.1.57810 WP_002938910.1.58229 WP_002938910.1.58517 WP_002938910.1.58566 WP_002938910.1.58585 WP_002938910.1.58706 WP_002938910.1.58746 WP_002938910.1.58793 WP_002938910.1.58815 WP_002938910.1.58903 WP_002938910.1.59071 WP_002938910.1.59138 WP_002938910.1.59144 WP_002938910.1.59283 WP_002938910.1.59349 WP_002938910.1.5936 WP_002938910.1.59524 WP_002938910.1.59647 WP_002938910.1.5974 WP_002938910.1.60237 WP_002938910.1.60293 WP_002938910.1.60377 WP_002938910.1.60445 WP_002938910.1.60658 WP_002938910.1.60659 WP_002938910.1.60853 WP_002938910.1.609 WP_002938910.1.61370 WP_002938910.1.61533 WP_002938910.1.61540 WP_002938910.1.6156 WP_002938910.1.6165 WP_002938910.1.61721 WP_002938910.1.61782 WP_002938910.1.6223 WP_002938910.1.62268 WP_002938910.1.62485 WP_002938910.1.6278 WP_002938910.1.62805 WP_002938910.1.63318 WP_002938910.1.63653 WP_002938910.1.63685 WP_002938910.1.63959 WP_002938910.1.64128 WP_002938910.1.64273 WP_002938910.1.64281 WP_002938910.1.64384 WP_002938910.1.64641 WP_002938910.1.64797 WP_002938910.1.64952 WP_002938910.1.65024 WP_002938910.1.65047 WP_002938910.1.65174 WP_002938910.1.65314 WP_002938910.1.65422 WP_002938910.1.65458 WP_002938910.1.65905 WP_002938910.1.65911 WP_002938910.1.65917 WP_002938910.1.6596 WP_002938910.1.66185 WP_002938910.1.66472 WP_002938910.1.66590 WP_002938910.1.66609 WP_002938910.1.66707 WP_002938910.1.6686 WP_002938910.1.6690 WP_002938910.1.66954 WP_002938910.1.67058 WP_002938910.1.67109 WP_002938910.1.6711 WP_002938910.1.67256 WP_002938910.1.67338 WP_002938910.1.67488 WP_002938910.1.677 WP_002938910.1.67883 WP_002938910.1.67897 WP_002938910.1.67958 WP_002938910.1.67962 WP_002938910.1.68010 WP_002938910.1.68303 WP_002938910.1.68602 WP_002938910.1.68666 WP_002938910.1.68739 WP_002938910.1.68791 WP_002938910.1.68941 WP_002938910.1.69115 WP_002938910.1.69161 WP_002938910.1.69413 WP_002938910.1.69454 WP_002938910.1.69698 WP_002938910.1.69706 WP_002938910.1.69922 WP_002938910.1.70033 WP_002938910.1.70387 WP_002938910.1.70403 WP_002938910.1.70817 WP_002938910.1.70997 WP_002938910.1.71125 WP_002938910.1.71140 WP_002938910.1.71425 WP_002938910.1.71498 WP_002938910.1.71727 WP_002938910.1.72174 WP_002938910.1.72247 WP_002938910.1.72296 WP_002938910.1.72413 WP_002938910.1.7257 WP_002938910.1.73011 WP_002938910.1.73262 WP_002938910.1.73280 WP_002938910.1.73299 WP_002938910.1.73679 WP_002938910.1.73721 WP_002938910.1.73905 WP_002938910.1.74567 WP_002938910.1.74800 WP_002938910.1.74843 WP_002938910.1.74865 WP_002938910.1.75022 WP_002938910.1.75028 WP_002938910.1.75229 WP_002938910.1.75605 WP_002938910.1.75930 WP_002938910.1.75965 WP_002938910.1.75985 WP_002938910.1.76083 WP_002938910.1.76175 WP_002938910.1.76400 WP_002938910.1.76735 WP_002938910.1.76907 WP_002938910.1.77006 WP_002938910.1.77616 WP_002938910.1.77624 WP_002938910.1.77781 WP_002938910.1.77795 WP_002938910.1.77958 WP_002938910.1.78326 WP_002938910.1.78456 WP_002938910.1.7873 WP_002938910.1.78744 WP_002938910.1.78792 WP_002938910.1.7884 WP_002938910.1.7889 WP_002938910.1.78945 WP_002938910.1.79054 WP_002938910.1.79154 WP_002938910.1.79162 WP_002938910.1.79499 WP_002938910.1.79644 WP_002938910.1.79679 WP_002938910.1.80097 WP_002938910.1.80131 WP_002938910.1.80153 WP_002938910.1.80169 WP_002938910.1.80216 WP_002938910.1.80235 WP_002938910.1.80418 WP_002938910.1.8061 WP_002938910.1.80716 WP_002938910.1.80742 WP_002938910.1.81103 WP_002938910.1.81370 WP_002938910.1.81513 WP_002938910.1.81584 WP_002938910.1.81705 WP_002938910.1.82122 WP_002938910.1.8251 WP_002938910.1.82830 WP_002938910.1.82870 WP_002938910.1.82977 WP_002938910.1.83818 WP_002938910.1.83915 WP_002938910.1.84389 WP_002938910.1.84489 WP_002938910.1.8451 WP_002938910.1.85051 WP_002938910.1.85075 WP_002938910.1.85327 WP_002938910.1.85437 WP_002938910.1.85908 WP_002938910.1.86151 WP_002938910.1.86177 WP_002938910.1.86817 WP_002938910.1.86836 WP_002938910.1.86842 WP_002938910.1.87044 WP_002938910.1.87321 WP_002938910.1.87344 WP_002938910.1.87438 WP_002938910.1.87450 WP_002938910.1.87819 WP_002938910.1.87874 WP_002938910.1.87885 WP_002938910.1.8790 WP_002938910.1.88173 WP_002938910.1.88543 WP_002938910.1.88575 WP_002938910.1.88653 WP_002938910.1.88779 WP_002938910.1.89037 WP_002938910.1.89038 WP_002938910.1.89056 WP_002938910.1.89128 WP_002938910.1.89156 WP_002938910.1.89279 WP_002938910.1.89358 WP_002938910.1.89388 WP_002938910.1.89800 WP_002938910.1.8993 WP_002938910.1.89989 WP_002938910.1.90172 WP_002938910.1.90419 WP_002938910.1.90742 WP_002938910.1.90961 WP_002938910.1.91238 WP_002938910.1.91636 WP_002938910.1.91792 WP_002938910.1.91912 WP_002938910.1.91973 WP_002938910.1.91983 WP_002938910.1.92134 WP_002938910.1.92263 WP_002938910.1.92441 WP_002938910.1.92554 WP_002938910.1.92692 WP_002938910.1.92722 WP_002938910.1.928 WP_002938910.1.93190 WP_002938910.1.93456 WP_002938910.1.93519 WP_002938910.1.9361 WP_002938910.1.93627 WP_002938910.1.93646 WP_002938910.1.9376 WP_002938910.1.93771 WP_002938910.1.93914 WP_002938910.1.94332 WP_002938910.1.94338 WP_002938910.1.94418 WP_002938910.1.94419 WP_002938910.1.94449 WP_002938910.1.9454 WP_002938910.1.94639 WP_002938910.1.94786 WP_002938910.1.94945 WP_002938910.1.95180 WP_002938910.1.95213 WP_002938910.1.95214 WP_002938910.1.95262 WP_002938910.1.95288 WP_002938910.1.95798 WP_002938910.1.96164 WP_002938910.1.96282 WP_002938910.1.96451 WP_002938910.1.9652 WP_002938910.1.96524 WP_002938910.1.96574 WP_002938910.1.96700 WP_002938910.1.97052 WP_002938910.1.97453 WP_002938910.1.97493 WP_002938910.1.97504 WP_002938910.1.97515 WP_002938910.1.97554 WP_002938910.1.97857 WP_002938910.1.9809 WP_002938910.1.9815 WP_002938910.1.98253 WP_002938910.1.98271 WP_002938910.1.98326 WP_002938910.1.98343 WP_002938910.1.98416 WP_002938910.1.98860 WP_002938910.1.98864 WP_002938910.1.98921 WP_002938910.1.99127 WP_002938910.1.9922 WP_002938910.1.99252 WP_002938910.1.99324 WP_002938910.1.99696 WP_002938910.1.99988 YP_003029013.1.79686 gi|386579490|ref|YP_006075895.1| gi|253753296|ref|YP_003026436.1| gi|253755873|ref|YP_003029013.1| gi|403061188|ref|YP_006649404.1| gi|386577552|ref|YP_006073957.1| gi|386581554|ref|YP_006077958.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]