SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253756097|ref|YP_003029237.1| from Streptococcus suis BM407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253756097|ref|YP_003029237.1|
Domain Number 1 Region: 1-276
Classification Level Classification E-value
Superfamily DAK1/DegV-like 7.32e-82
Family DegV-like 0.0000741
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|253756097|ref|YP_003029237.1|
Sequence length 277
Comment hypothetical protein SSUBM407_1537 [Streptococcus suis BM407]
Sequence
MSKIKIVTDSSTTIEPSLVEELNITVVPLSVMVDGVVYSDNDLKEGEFLELMRGSKNLPK
TSQPPVGLFAETFAELAKDGSQIIAILLSHALSGTVEAARQGATLSGADVTILDSSFTDQ
AEKFQVVEAARMAQAGASKEEILAAIETVKEKTELYIGVSTLENLVKGGRIGRVQGMLSS
LLNIRVIMEMKDHQLTPIVKGRGNKTFKKWLEEFTATLADKKVAEIGISYSGTAYFANEM
KSQLQEYVSKEISVLETGSIIQTHTGEDAWAILLRYE
Download sequence
Identical sequences A0A0H3N114
WP_012775670.1.101621 WP_012775670.1.10700 WP_012775670.1.11017 WP_012775670.1.1244 WP_012775670.1.13095 WP_012775670.1.15756 WP_012775670.1.16498 WP_012775670.1.16683 WP_012775670.1.16829 WP_012775670.1.16881 WP_012775670.1.17814 WP_012775670.1.18403 WP_012775670.1.19898 WP_012775670.1.21903 WP_012775670.1.23682 WP_012775670.1.23965 WP_012775670.1.24431 WP_012775670.1.25245 WP_012775670.1.25617 WP_012775670.1.25711 WP_012775670.1.26620 WP_012775670.1.27227 WP_012775670.1.27695 WP_012775670.1.30079 WP_012775670.1.34652 WP_012775670.1.35725 WP_012775670.1.36251 WP_012775670.1.37688 WP_012775670.1.37816 WP_012775670.1.37915 WP_012775670.1.41854 WP_012775670.1.42827 WP_012775670.1.44592 WP_012775670.1.47375 WP_012775670.1.47745 WP_012775670.1.49099 WP_012775670.1.53749 WP_012775670.1.54800 WP_012775670.1.55064 WP_012775670.1.55815 WP_012775670.1.56140 WP_012775670.1.56434 WP_012775670.1.57164 WP_012775670.1.58585 WP_012775670.1.58815 WP_012775670.1.59138 WP_012775670.1.59647 WP_012775670.1.60293 WP_012775670.1.60377 WP_012775670.1.60659 WP_012775670.1.61370 WP_012775670.1.62268 WP_012775670.1.63653 WP_012775670.1.65174 WP_012775670.1.65314 WP_012775670.1.66609 WP_012775670.1.67256 WP_012775670.1.67338 WP_012775670.1.67883 WP_012775670.1.67897 WP_012775670.1.68739 WP_012775670.1.68941 WP_012775670.1.69698 WP_012775670.1.70817 WP_012775670.1.71498 WP_012775670.1.72174 WP_012775670.1.74800 WP_012775670.1.75022 WP_012775670.1.75965 WP_012775670.1.78456 WP_012775670.1.78744 WP_012775670.1.78792 WP_012775670.1.7889 WP_012775670.1.79154 WP_012775670.1.79644 WP_012775670.1.79679 WP_012775670.1.80169 WP_012775670.1.82122 WP_012775670.1.85327 WP_012775670.1.86842 WP_012775670.1.87344 WP_012775670.1.87438 WP_012775670.1.87450 WP_012775670.1.87874 WP_012775670.1.89128 WP_012775670.1.90419 WP_012775670.1.928 WP_012775670.1.93456 WP_012775670.1.93771 WP_012775670.1.94419 WP_012775670.1.94945 WP_012775670.1.96451 WP_012775670.1.97504 YP_003029237.1.79686 568814.SSUBM407_1537 gi|253756097|ref|YP_003029237.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]