SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253756285|ref|YP_003029425.1| from Streptococcus suis BM407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253756285|ref|YP_003029425.1|
Domain Number 1 Region: 2-200
Classification Level Classification E-value
Superfamily DhaL-like 3.66e-48
Family DhaL-like 0.0022
Further Details:      
 
Weak hits

Sequence:  gi|253756285|ref|YP_003029425.1|
Domain Number - Region: 479-542
Classification Level Classification E-value
Superfamily DAK1/DegV-like 0.0288
Family DegV-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|253756285|ref|YP_003029425.1|
Sequence length 554
Comment dihydroxyacetone kinase family protein [Streptococcus suis BM407]
Sequence
MSKITTSLFQEMVQAASTRLNKQAEYVNSLNVFPVPDGDTGTNMGMTITNGAKEVADKSA
STVGEVAQILSKGLLMGARGNSGVITSQLFRGFGQSVKGKVELDGKDLAQAFQHGVEVAY
KAVMKPVEGTILTVSRGAATAALKKAEETDDAVEVMRATLDGANRALKKTPEMLPVLKEV
GVVDSGGQGLVYIYEGFLSALTGEYIASEDFEATPAVMSEMINAEHHKSVAGHVATEDIT
FGYCTEIMVALRQGPTYVKDFDYEEFRNYLNDLGDSLLVVNDDEIVKVHVHTEDPGLVMQ
AGLQYGSLVKVKVDNMREQHEAQVEKVESFQKPAEQKEYAIIAVAAGEGLTEIFKSQGVD
YVISGGQTMNPSTEDFVNAIELVNARNVILLPNNKNILMAAQTAAEVAEVAVKVVETKTL
PQGFTSLLAFDPSRDLESNFEAMTASLAEVKSGSVTTAVRDTTIDGLEIHENDNLGMVDG
KIVVSNPDMMETLVATFDKMLDEDSEIVTIYIGEDGNEELAQTLAEQLEEQFEDVEVEIH
QGNQPVYPYLFSVE
Download sequence
Identical sequences A0A0H3MX38 A0A2K1SJ89 D5AJW8
gi|403062283|ref|YP_006650499.1| gi|476420661|ref|YP_007571657.1| gi|253752525|ref|YP_003025666.1| gi|253754351|ref|YP_003027492.1| 218494.SSU1656 391296.SSU98_1864 568813.SSUSC84_1681 568814.SSUBM407_1729 gi|386578669|ref|YP_006075075.1| gi|386582818|ref|YP_006079222.1| WP_012028485.1.10007 WP_012028485.1.100280 WP_012028485.1.100404 WP_012028485.1.100701 WP_012028485.1.100908 WP_012028485.1.101097 WP_012028485.1.101179 WP_012028485.1.101295 WP_012028485.1.101621 WP_012028485.1.101658 WP_012028485.1.101706 WP_012028485.1.102038 WP_012028485.1.10265 WP_012028485.1.1035 WP_012028485.1.10700 WP_012028485.1.10896 WP_012028485.1.11017 WP_012028485.1.11330 WP_012028485.1.11548 WP_012028485.1.11662 WP_012028485.1.11869 WP_012028485.1.11874 WP_012028485.1.1200 WP_012028485.1.12022 WP_012028485.1.12228 WP_012028485.1.12288 WP_012028485.1.1244 WP_012028485.1.12606 WP_012028485.1.12803 WP_012028485.1.13095 WP_012028485.1.1324 WP_012028485.1.13380 WP_012028485.1.13633 WP_012028485.1.13861 WP_012028485.1.1405 WP_012028485.1.14202 WP_012028485.1.14210 WP_012028485.1.1424 WP_012028485.1.1434 WP_012028485.1.14359 WP_012028485.1.1495 WP_012028485.1.1537 WP_012028485.1.15393 WP_012028485.1.15545 WP_012028485.1.15756 WP_012028485.1.15813 WP_012028485.1.16193 WP_012028485.1.1629 WP_012028485.1.16498 WP_012028485.1.16643 WP_012028485.1.16683 WP_012028485.1.16773 WP_012028485.1.16829 WP_012028485.1.16881 WP_012028485.1.17264 WP_012028485.1.17670 WP_012028485.1.17749 WP_012028485.1.17814 WP_012028485.1.17958 WP_012028485.1.17989 WP_012028485.1.18271 WP_012028485.1.18341 WP_012028485.1.18403 WP_012028485.1.18563 WP_012028485.1.18711 WP_012028485.1.18850 WP_012028485.1.19352 WP_012028485.1.19378 WP_012028485.1.1953 WP_012028485.1.19865 WP_012028485.1.19898 WP_012028485.1.20400 WP_012028485.1.20518 WP_012028485.1.20584 WP_012028485.1.20756 WP_012028485.1.20819 WP_012028485.1.20944 WP_012028485.1.21347 WP_012028485.1.21457 WP_012028485.1.21903 WP_012028485.1.22785 WP_012028485.1.22882 WP_012028485.1.23089 WP_012028485.1.23273 WP_012028485.1.23317 WP_012028485.1.23358 WP_012028485.1.23682 WP_012028485.1.23965 WP_012028485.1.24078 WP_012028485.1.24150 WP_012028485.1.24175 WP_012028485.1.24187 WP_012028485.1.24431 WP_012028485.1.24858 WP_012028485.1.24883 WP_012028485.1.25245 WP_012028485.1.25280 WP_012028485.1.25381 WP_012028485.1.25396 WP_012028485.1.25617 WP_012028485.1.25711 WP_012028485.1.25824 WP_012028485.1.25950 WP_012028485.1.26009 WP_012028485.1.26302 WP_012028485.1.26368 WP_012028485.1.26620 WP_012028485.1.27108 WP_012028485.1.27225 WP_012028485.1.27227 WP_012028485.1.27381 WP_012028485.1.27476 WP_012028485.1.27754 WP_012028485.1.27760 WP_012028485.1.27767 WP_012028485.1.28000 WP_012028485.1.28033 WP_012028485.1.28244 WP_012028485.1.28467 WP_012028485.1.28645 WP_012028485.1.28796 WP_012028485.1.28805 WP_012028485.1.29141 WP_012028485.1.29610 WP_012028485.1.30079 WP_012028485.1.30241 WP_012028485.1.30414 WP_012028485.1.30785 WP_012028485.1.31597 WP_012028485.1.31730 WP_012028485.1.32259 WP_012028485.1.32332 WP_012028485.1.32466 WP_012028485.1.32630 WP_012028485.1.32947 WP_012028485.1.33330 WP_012028485.1.34321 WP_012028485.1.34425 WP_012028485.1.34527 WP_012028485.1.34652 WP_012028485.1.34738 WP_012028485.1.35430 WP_012028485.1.35551 WP_012028485.1.35675 WP_012028485.1.35725 WP_012028485.1.36136 WP_012028485.1.36251 WP_012028485.1.36341 WP_012028485.1.36611 WP_012028485.1.36766 WP_012028485.1.36945 WP_012028485.1.37126 WP_012028485.1.37237 WP_012028485.1.376 WP_012028485.1.37653 WP_012028485.1.37688 WP_012028485.1.37816 WP_012028485.1.37841 WP_012028485.1.37915 WP_012028485.1.38409 WP_012028485.1.38470 WP_012028485.1.39011 WP_012028485.1.39023 WP_012028485.1.39247 WP_012028485.1.39280 WP_012028485.1.39714 WP_012028485.1.3989 WP_012028485.1.40062 WP_012028485.1.40141 WP_012028485.1.40228 WP_012028485.1.40384 WP_012028485.1.40507 WP_012028485.1.4074 WP_012028485.1.40802 WP_012028485.1.41046 WP_012028485.1.41112 WP_012028485.1.41280 WP_012028485.1.41340 WP_012028485.1.42323 WP_012028485.1.42552 WP_012028485.1.42596 WP_012028485.1.42732 WP_012028485.1.4278 WP_012028485.1.42784 WP_012028485.1.42827 WP_012028485.1.42840 WP_012028485.1.4291 WP_012028485.1.43264 WP_012028485.1.43288 WP_012028485.1.43482 WP_012028485.1.43813 WP_012028485.1.43922 WP_012028485.1.43963 WP_012028485.1.43977 WP_012028485.1.44047 WP_012028485.1.44128 WP_012028485.1.44592 WP_012028485.1.44676 WP_012028485.1.44778 WP_012028485.1.45088 WP_012028485.1.45216 WP_012028485.1.45219 WP_012028485.1.45278 WP_012028485.1.45345 WP_012028485.1.45864 WP_012028485.1.45936 WP_012028485.1.467 WP_012028485.1.46880 WP_012028485.1.47315 WP_012028485.1.47434 WP_012028485.1.4748 WP_012028485.1.4757 WP_012028485.1.47643 WP_012028485.1.47745 WP_012028485.1.47894 WP_012028485.1.47900 WP_012028485.1.48167 WP_012028485.1.48217 WP_012028485.1.48397 WP_012028485.1.48603 WP_012028485.1.49093 WP_012028485.1.49099 WP_012028485.1.49206 WP_012028485.1.49255 WP_012028485.1.49368 WP_012028485.1.49413 WP_012028485.1.49509 WP_012028485.1.49782 WP_012028485.1.49968 WP_012028485.1.50047 WP_012028485.1.5021 WP_012028485.1.50437 WP_012028485.1.50538 WP_012028485.1.50551 WP_012028485.1.50675 WP_012028485.1.50751 WP_012028485.1.5079 WP_012028485.1.50798 WP_012028485.1.51263 WP_012028485.1.51386 WP_012028485.1.51551 WP_012028485.1.52159 WP_012028485.1.52175 WP_012028485.1.52599 WP_012028485.1.52628 WP_012028485.1.52798 WP_012028485.1.53174 WP_012028485.1.53290 WP_012028485.1.53309 WP_012028485.1.534 WP_012028485.1.53448 WP_012028485.1.53487 WP_012028485.1.53749 WP_012028485.1.53805 WP_012028485.1.54000 WP_012028485.1.5404 WP_012028485.1.54184 WP_012028485.1.54384 WP_012028485.1.54488 WP_012028485.1.54535 WP_012028485.1.54800 WP_012028485.1.54828 WP_012028485.1.55064 WP_012028485.1.55137 WP_012028485.1.55158 WP_012028485.1.55649 WP_012028485.1.55687 WP_012028485.1.5579 WP_012028485.1.55815 WP_012028485.1.55833 WP_012028485.1.55834 WP_012028485.1.56140 WP_012028485.1.56215 WP_012028485.1.56434 WP_012028485.1.56463 WP_012028485.1.57067 WP_012028485.1.5714 WP_012028485.1.57164 WP_012028485.1.5754 WP_012028485.1.57640 WP_012028485.1.57674 WP_012028485.1.57810 WP_012028485.1.58229 WP_012028485.1.58517 WP_012028485.1.58566 WP_012028485.1.58706 WP_012028485.1.58746 WP_012028485.1.58793 WP_012028485.1.58815 WP_012028485.1.58903 WP_012028485.1.59071 WP_012028485.1.59138 WP_012028485.1.59144 WP_012028485.1.59283 WP_012028485.1.59349 WP_012028485.1.5936 WP_012028485.1.59524 WP_012028485.1.59647 WP_012028485.1.5974 WP_012028485.1.60237 WP_012028485.1.60293 WP_012028485.1.60377 WP_012028485.1.60445 WP_012028485.1.60658 WP_012028485.1.60659 WP_012028485.1.60853 WP_012028485.1.609 WP_012028485.1.61370 WP_012028485.1.61533 WP_012028485.1.61540 WP_012028485.1.6156 WP_012028485.1.6165 WP_012028485.1.61721 WP_012028485.1.61782 WP_012028485.1.6223 WP_012028485.1.62268 WP_012028485.1.62485 WP_012028485.1.6278 WP_012028485.1.62805 WP_012028485.1.63318 WP_012028485.1.63653 WP_012028485.1.63685 WP_012028485.1.63959 WP_012028485.1.64128 WP_012028485.1.64273 WP_012028485.1.64281 WP_012028485.1.64384 WP_012028485.1.64641 WP_012028485.1.64797 WP_012028485.1.64952 WP_012028485.1.65024 WP_012028485.1.65047 WP_012028485.1.65174 WP_012028485.1.65314 WP_012028485.1.65422 WP_012028485.1.65458 WP_012028485.1.65905 WP_012028485.1.65911 WP_012028485.1.65917 WP_012028485.1.6596 WP_012028485.1.66185 WP_012028485.1.66472 WP_012028485.1.66590 WP_012028485.1.66609 WP_012028485.1.66707 WP_012028485.1.6686 WP_012028485.1.66954 WP_012028485.1.67058 WP_012028485.1.67109 WP_012028485.1.6711 WP_012028485.1.67256 WP_012028485.1.67338 WP_012028485.1.67488 WP_012028485.1.677 WP_012028485.1.67883 WP_012028485.1.67897 WP_012028485.1.67958 WP_012028485.1.67962 WP_012028485.1.68010 WP_012028485.1.68303 WP_012028485.1.68602 WP_012028485.1.68666 WP_012028485.1.68739 WP_012028485.1.68791 WP_012028485.1.68941 WP_012028485.1.69115 WP_012028485.1.69161 WP_012028485.1.69413 WP_012028485.1.69454 WP_012028485.1.69698 WP_012028485.1.69706 WP_012028485.1.69922 WP_012028485.1.70033 WP_012028485.1.70387 WP_012028485.1.70817 WP_012028485.1.70997 WP_012028485.1.71125 WP_012028485.1.71140 WP_012028485.1.71425 WP_012028485.1.71498 WP_012028485.1.71727 WP_012028485.1.72174 WP_012028485.1.72247 WP_012028485.1.72296 WP_012028485.1.72413 WP_012028485.1.73011 WP_012028485.1.73262 WP_012028485.1.73280 WP_012028485.1.73299 WP_012028485.1.73679 WP_012028485.1.73721 WP_012028485.1.73905 WP_012028485.1.74567 WP_012028485.1.74843 WP_012028485.1.74865 WP_012028485.1.75022 WP_012028485.1.75028 WP_012028485.1.75605 WP_012028485.1.75930 WP_012028485.1.75965 WP_012028485.1.75985 WP_012028485.1.76083 WP_012028485.1.76175 WP_012028485.1.76400 WP_012028485.1.76735 WP_012028485.1.76907 WP_012028485.1.77006 WP_012028485.1.77616 WP_012028485.1.77624 WP_012028485.1.77781 WP_012028485.1.77795 WP_012028485.1.77958 WP_012028485.1.78326 WP_012028485.1.78456 WP_012028485.1.7873 WP_012028485.1.78744 WP_012028485.1.78792 WP_012028485.1.7889 WP_012028485.1.78945 WP_012028485.1.79054 WP_012028485.1.79154 WP_012028485.1.79162 WP_012028485.1.79499 WP_012028485.1.79644 WP_012028485.1.79679 WP_012028485.1.80097 WP_012028485.1.80131 WP_012028485.1.80153 WP_012028485.1.80169 WP_012028485.1.80216 WP_012028485.1.8061 WP_012028485.1.80716 WP_012028485.1.80742 WP_012028485.1.81103 WP_012028485.1.81370 WP_012028485.1.81513 WP_012028485.1.81584 WP_012028485.1.81705 WP_012028485.1.82122 WP_012028485.1.8251 WP_012028485.1.82830 WP_012028485.1.82870 WP_012028485.1.82977 WP_012028485.1.83818 WP_012028485.1.83915 WP_012028485.1.84389 WP_012028485.1.8451 WP_012028485.1.85051 WP_012028485.1.85075 WP_012028485.1.85327 WP_012028485.1.85437 WP_012028485.1.85908 WP_012028485.1.86151 WP_012028485.1.86177 WP_012028485.1.86817 WP_012028485.1.86836 WP_012028485.1.86842 WP_012028485.1.87044 WP_012028485.1.87321 WP_012028485.1.87344 WP_012028485.1.87438 WP_012028485.1.87819 WP_012028485.1.87874 WP_012028485.1.87885 WP_012028485.1.8790 WP_012028485.1.88543 WP_012028485.1.88575 WP_012028485.1.88653 WP_012028485.1.88779 WP_012028485.1.89037 WP_012028485.1.89038 WP_012028485.1.89056 WP_012028485.1.89128 WP_012028485.1.89156 WP_012028485.1.89279 WP_012028485.1.89358 WP_012028485.1.89388 WP_012028485.1.89800 WP_012028485.1.8993 WP_012028485.1.89989 WP_012028485.1.90172 WP_012028485.1.90419 WP_012028485.1.90742 WP_012028485.1.90961 WP_012028485.1.91238 WP_012028485.1.91636 WP_012028485.1.91865 WP_012028485.1.91912 WP_012028485.1.91973 WP_012028485.1.91983 WP_012028485.1.92134 WP_012028485.1.92263 WP_012028485.1.92441 WP_012028485.1.92554 WP_012028485.1.92692 WP_012028485.1.92722 WP_012028485.1.928 WP_012028485.1.93190 WP_012028485.1.93456 WP_012028485.1.93519 WP_012028485.1.9361 WP_012028485.1.93627 WP_012028485.1.93646 WP_012028485.1.9376 WP_012028485.1.93771 WP_012028485.1.94332 WP_012028485.1.94338 WP_012028485.1.94418 WP_012028485.1.94419 WP_012028485.1.94449 WP_012028485.1.9454 WP_012028485.1.94639 WP_012028485.1.94786 WP_012028485.1.94945 WP_012028485.1.95180 WP_012028485.1.95213 WP_012028485.1.95214 WP_012028485.1.95262 WP_012028485.1.95288 WP_012028485.1.95542 WP_012028485.1.95798 WP_012028485.1.96164 WP_012028485.1.96282 WP_012028485.1.96451 WP_012028485.1.9652 WP_012028485.1.96524 WP_012028485.1.96574 WP_012028485.1.96700 WP_012028485.1.97052 WP_012028485.1.97453 WP_012028485.1.97493 WP_012028485.1.97504 WP_012028485.1.97554 WP_012028485.1.97857 WP_012028485.1.9809 WP_012028485.1.9815 WP_012028485.1.98253 WP_012028485.1.98271 WP_012028485.1.98326 WP_012028485.1.98343 WP_012028485.1.98416 WP_012028485.1.98860 WP_012028485.1.98864 WP_012028485.1.98921 WP_012028485.1.99127 WP_012028485.1.9922 WP_012028485.1.99252 WP_012028485.1.99324 WP_012028485.1.99696 WP_012028485.1.99988 YP_003029425.1.79686 gi|253756285|ref|YP_003029425.1| gi|386588940|ref|YP_006085341.1| gi|146321711|ref|YP_001201422.1| gi|386580742|ref|YP_006077147.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]