SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253756317|ref|YP_003029457.1| from Streptococcus suis BM407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253756317|ref|YP_003029457.1|
Domain Number 1 Region: 1-280
Classification Level Classification E-value
Superfamily DAK1/DegV-like 2.88e-80
Family DegV-like 0.00000384
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|253756317|ref|YP_003029457.1|
Sequence length 287
Comment DegV family protein [Streptococcus suis BM407]
Sequence
MTFTIVTDSTSDLPISWVQENDVTVLGLTINLDGATYETVGENRLTSADLLEKMASGSQP
TTSQVNVGQFEEVFEAAAKEDHEVLYLAFSAALSGTYQSAVIARDMVMDQYPEAVITIVD
TKAATIGEGYLVMKAVEARAAGKTLAETKAIVEDLVPRLRTYLLVDDLNHLVRGGRLSKA
AALIGGLVNIKPLLALNAEGKLEAIAKIRGRKKGIKEMLNLTLDNLDHSTVMVAYTGDIE
AAEGVKSSLLEDDRISDVLLTELGPVIATHTGTGVLAILSIGTAMRA
Download sequence
Identical sequences A0A0H3MXX1 A0A2K1SXS3 D5AK05
gi|253752557|ref|YP_003025698.1| gi|386582856|ref|YP_006079260.1| gi|476420695|ref|YP_007571691.1| gi|386588977|ref|YP_006085378.1| gi|253754383|ref|YP_003027524.1| gi|253756317|ref|YP_003029457.1| gi|386578706|ref|YP_006075112.1| gi|386580779|ref|YP_006077184.1| gi|146321748|ref|YP_001201459.1| 218494.SSU1694 391296.SSU98_1901 568813.SSUSC84_1717 568814.SSUBM407_1765 WP_012028496.1.10007 WP_012028496.1.100280 WP_012028496.1.100404 WP_012028496.1.100701 WP_012028496.1.100908 WP_012028496.1.101097 WP_012028496.1.101179 WP_012028496.1.101295 WP_012028496.1.101621 WP_012028496.1.101658 WP_012028496.1.101706 WP_012028496.1.102038 WP_012028496.1.10265 WP_012028496.1.1035 WP_012028496.1.10700 WP_012028496.1.10896 WP_012028496.1.11017 WP_012028496.1.11330 WP_012028496.1.11548 WP_012028496.1.11662 WP_012028496.1.11869 WP_012028496.1.11874 WP_012028496.1.1200 WP_012028496.1.12022 WP_012028496.1.12228 WP_012028496.1.12288 WP_012028496.1.1244 WP_012028496.1.12606 WP_012028496.1.12803 WP_012028496.1.13095 WP_012028496.1.1324 WP_012028496.1.13380 WP_012028496.1.13633 WP_012028496.1.13861 WP_012028496.1.1405 WP_012028496.1.14202 WP_012028496.1.14210 WP_012028496.1.1424 WP_012028496.1.1434 WP_012028496.1.14359 WP_012028496.1.1495 WP_012028496.1.15112 WP_012028496.1.1537 WP_012028496.1.15393 WP_012028496.1.15545 WP_012028496.1.15756 WP_012028496.1.15813 WP_012028496.1.16193 WP_012028496.1.1629 WP_012028496.1.16498 WP_012028496.1.16643 WP_012028496.1.16683 WP_012028496.1.16773 WP_012028496.1.16829 WP_012028496.1.16881 WP_012028496.1.17264 WP_012028496.1.17670 WP_012028496.1.17749 WP_012028496.1.17814 WP_012028496.1.17958 WP_012028496.1.17989 WP_012028496.1.18271 WP_012028496.1.18341 WP_012028496.1.18403 WP_012028496.1.18563 WP_012028496.1.18711 WP_012028496.1.18850 WP_012028496.1.19352 WP_012028496.1.19378 WP_012028496.1.1953 WP_012028496.1.19865 WP_012028496.1.19898 WP_012028496.1.20400 WP_012028496.1.20518 WP_012028496.1.20584 WP_012028496.1.20756 WP_012028496.1.20944 WP_012028496.1.21072 WP_012028496.1.21347 WP_012028496.1.21457 WP_012028496.1.21903 WP_012028496.1.22785 WP_012028496.1.23089 WP_012028496.1.23273 WP_012028496.1.23317 WP_012028496.1.23358 WP_012028496.1.23682 WP_012028496.1.23965 WP_012028496.1.24078 WP_012028496.1.24150 WP_012028496.1.24175 WP_012028496.1.24187 WP_012028496.1.24431 WP_012028496.1.24858 WP_012028496.1.24883 WP_012028496.1.25245 WP_012028496.1.25280 WP_012028496.1.25381 WP_012028496.1.25396 WP_012028496.1.25617 WP_012028496.1.25711 WP_012028496.1.25798 WP_012028496.1.25824 WP_012028496.1.25950 WP_012028496.1.26009 WP_012028496.1.26302 WP_012028496.1.26368 WP_012028496.1.26620 WP_012028496.1.27108 WP_012028496.1.27225 WP_012028496.1.27227 WP_012028496.1.27381 WP_012028496.1.27476 WP_012028496.1.27695 WP_012028496.1.27754 WP_012028496.1.27760 WP_012028496.1.27767 WP_012028496.1.28000 WP_012028496.1.28033 WP_012028496.1.28244 WP_012028496.1.28467 WP_012028496.1.28645 WP_012028496.1.28796 WP_012028496.1.28805 WP_012028496.1.29141 WP_012028496.1.29610 WP_012028496.1.29635 WP_012028496.1.30079 WP_012028496.1.30136 WP_012028496.1.30241 WP_012028496.1.30414 WP_012028496.1.30785 WP_012028496.1.31597 WP_012028496.1.31707 WP_012028496.1.31730 WP_012028496.1.31763 WP_012028496.1.32048 WP_012028496.1.32259 WP_012028496.1.32466 WP_012028496.1.32630 WP_012028496.1.32947 WP_012028496.1.33330 WP_012028496.1.34321 WP_012028496.1.34425 WP_012028496.1.34527 WP_012028496.1.34652 WP_012028496.1.34738 WP_012028496.1.35430 WP_012028496.1.35551 WP_012028496.1.35675 WP_012028496.1.35725 WP_012028496.1.36136 WP_012028496.1.36251 WP_012028496.1.36341 WP_012028496.1.36611 WP_012028496.1.36766 WP_012028496.1.36945 WP_012028496.1.37126 WP_012028496.1.37237 WP_012028496.1.376 WP_012028496.1.37653 WP_012028496.1.37688 WP_012028496.1.37816 WP_012028496.1.37841 WP_012028496.1.37915 WP_012028496.1.38409 WP_012028496.1.38470 WP_012028496.1.39011 WP_012028496.1.39023 WP_012028496.1.39247 WP_012028496.1.39280 WP_012028496.1.39714 WP_012028496.1.3989 WP_012028496.1.40062 WP_012028496.1.40141 WP_012028496.1.40228 WP_012028496.1.40384 WP_012028496.1.40507 WP_012028496.1.40669 WP_012028496.1.4074 WP_012028496.1.40802 WP_012028496.1.41046 WP_012028496.1.41112 WP_012028496.1.41280 WP_012028496.1.41340 WP_012028496.1.41854 WP_012028496.1.42323 WP_012028496.1.42552 WP_012028496.1.42596 WP_012028496.1.42732 WP_012028496.1.4278 WP_012028496.1.42784 WP_012028496.1.42827 WP_012028496.1.42840 WP_012028496.1.4291 WP_012028496.1.43264 WP_012028496.1.43288 WP_012028496.1.43482 WP_012028496.1.43813 WP_012028496.1.43922 WP_012028496.1.43963 WP_012028496.1.43977 WP_012028496.1.44047 WP_012028496.1.44128 WP_012028496.1.44592 WP_012028496.1.44676 WP_012028496.1.44778 WP_012028496.1.45088 WP_012028496.1.45216 WP_012028496.1.45219 WP_012028496.1.45278 WP_012028496.1.45345 WP_012028496.1.45864 WP_012028496.1.45936 WP_012028496.1.467 WP_012028496.1.46880 WP_012028496.1.47315 WP_012028496.1.47375 WP_012028496.1.47434 WP_012028496.1.4748 WP_012028496.1.4757 WP_012028496.1.47745 WP_012028496.1.47894 WP_012028496.1.47900 WP_012028496.1.48167 WP_012028496.1.48217 WP_012028496.1.48397 WP_012028496.1.48603 WP_012028496.1.49093 WP_012028496.1.49099 WP_012028496.1.49206 WP_012028496.1.49255 WP_012028496.1.49368 WP_012028496.1.49413 WP_012028496.1.49509 WP_012028496.1.49782 WP_012028496.1.49968 WP_012028496.1.50047 WP_012028496.1.5021 WP_012028496.1.50437 WP_012028496.1.50538 WP_012028496.1.50551 WP_012028496.1.50675 WP_012028496.1.50751 WP_012028496.1.5079 WP_012028496.1.50798 WP_012028496.1.51263 WP_012028496.1.51386 WP_012028496.1.51551 WP_012028496.1.52159 WP_012028496.1.52175 WP_012028496.1.52599 WP_012028496.1.52628 WP_012028496.1.52798 WP_012028496.1.53174 WP_012028496.1.53290 WP_012028496.1.53309 WP_012028496.1.534 WP_012028496.1.53448 WP_012028496.1.53487 WP_012028496.1.53749 WP_012028496.1.53805 WP_012028496.1.53918 WP_012028496.1.54000 WP_012028496.1.5404 WP_012028496.1.54184 WP_012028496.1.54384 WP_012028496.1.54488 WP_012028496.1.54535 WP_012028496.1.54683 WP_012028496.1.54800 WP_012028496.1.54828 WP_012028496.1.55064 WP_012028496.1.55137 WP_012028496.1.55158 WP_012028496.1.55649 WP_012028496.1.55687 WP_012028496.1.5579 WP_012028496.1.55815 WP_012028496.1.55833 WP_012028496.1.55834 WP_012028496.1.56140 WP_012028496.1.56215 WP_012028496.1.56434 WP_012028496.1.56463 WP_012028496.1.57067 WP_012028496.1.5714 WP_012028496.1.57164 WP_012028496.1.57189 WP_012028496.1.5754 WP_012028496.1.57640 WP_012028496.1.57674 WP_012028496.1.57810 WP_012028496.1.58229 WP_012028496.1.58517 WP_012028496.1.58566 WP_012028496.1.58585 WP_012028496.1.58706 WP_012028496.1.58746 WP_012028496.1.58793 WP_012028496.1.58815 WP_012028496.1.58903 WP_012028496.1.59071 WP_012028496.1.59138 WP_012028496.1.59144 WP_012028496.1.59283 WP_012028496.1.59349 WP_012028496.1.5936 WP_012028496.1.59524 WP_012028496.1.59647 WP_012028496.1.5974 WP_012028496.1.60237 WP_012028496.1.60293 WP_012028496.1.60377 WP_012028496.1.60445 WP_012028496.1.60658 WP_012028496.1.60659 WP_012028496.1.60853 WP_012028496.1.609 WP_012028496.1.61370 WP_012028496.1.61533 WP_012028496.1.61540 WP_012028496.1.6156 WP_012028496.1.6165 WP_012028496.1.61782 WP_012028496.1.6223 WP_012028496.1.62268 WP_012028496.1.62485 WP_012028496.1.6278 WP_012028496.1.62805 WP_012028496.1.63318 WP_012028496.1.63653 WP_012028496.1.63685 WP_012028496.1.63959 WP_012028496.1.64128 WP_012028496.1.64273 WP_012028496.1.64281 WP_012028496.1.64384 WP_012028496.1.64641 WP_012028496.1.64797 WP_012028496.1.64952 WP_012028496.1.65024 WP_012028496.1.65047 WP_012028496.1.65174 WP_012028496.1.65314 WP_012028496.1.65422 WP_012028496.1.65458 WP_012028496.1.65905 WP_012028496.1.65911 WP_012028496.1.65917 WP_012028496.1.6596 WP_012028496.1.66185 WP_012028496.1.66472 WP_012028496.1.66590 WP_012028496.1.66609 WP_012028496.1.66707 WP_012028496.1.6686 WP_012028496.1.66954 WP_012028496.1.67058 WP_012028496.1.67109 WP_012028496.1.6711 WP_012028496.1.67256 WP_012028496.1.67338 WP_012028496.1.67488 WP_012028496.1.677 WP_012028496.1.67883 WP_012028496.1.67897 WP_012028496.1.67958 WP_012028496.1.67962 WP_012028496.1.68010 WP_012028496.1.68303 WP_012028496.1.68666 WP_012028496.1.68739 WP_012028496.1.68791 WP_012028496.1.68941 WP_012028496.1.69115 WP_012028496.1.69413 WP_012028496.1.69454 WP_012028496.1.69698 WP_012028496.1.69706 WP_012028496.1.69922 WP_012028496.1.70033 WP_012028496.1.70387 WP_012028496.1.70403 WP_012028496.1.70817 WP_012028496.1.70997 WP_012028496.1.71125 WP_012028496.1.71140 WP_012028496.1.71425 WP_012028496.1.71498 WP_012028496.1.71727 WP_012028496.1.72174 WP_012028496.1.72247 WP_012028496.1.72296 WP_012028496.1.72413 WP_012028496.1.7257 WP_012028496.1.73011 WP_012028496.1.73262 WP_012028496.1.73280 WP_012028496.1.73299 WP_012028496.1.73679 WP_012028496.1.73721 WP_012028496.1.73905 WP_012028496.1.74567 WP_012028496.1.74800 WP_012028496.1.74843 WP_012028496.1.74865 WP_012028496.1.75022 WP_012028496.1.75028 WP_012028496.1.75605 WP_012028496.1.75930 WP_012028496.1.75965 WP_012028496.1.75985 WP_012028496.1.76083 WP_012028496.1.76175 WP_012028496.1.76400 WP_012028496.1.76735 WP_012028496.1.76907 WP_012028496.1.77006 WP_012028496.1.77616 WP_012028496.1.77624 WP_012028496.1.77781 WP_012028496.1.77795 WP_012028496.1.77958 WP_012028496.1.78326 WP_012028496.1.78456 WP_012028496.1.7873 WP_012028496.1.78744 WP_012028496.1.78792 WP_012028496.1.7889 WP_012028496.1.78945 WP_012028496.1.79054 WP_012028496.1.79154 WP_012028496.1.79162 WP_012028496.1.79499 WP_012028496.1.79644 WP_012028496.1.79679 WP_012028496.1.80097 WP_012028496.1.80131 WP_012028496.1.80153 WP_012028496.1.80169 WP_012028496.1.80216 WP_012028496.1.80235 WP_012028496.1.80418 WP_012028496.1.8061 WP_012028496.1.80716 WP_012028496.1.80742 WP_012028496.1.81103 WP_012028496.1.81370 WP_012028496.1.81513 WP_012028496.1.81584 WP_012028496.1.81705 WP_012028496.1.82122 WP_012028496.1.8251 WP_012028496.1.82830 WP_012028496.1.82870 WP_012028496.1.82977 WP_012028496.1.83818 WP_012028496.1.83915 WP_012028496.1.84389 WP_012028496.1.84489 WP_012028496.1.8451 WP_012028496.1.85051 WP_012028496.1.85075 WP_012028496.1.85327 WP_012028496.1.85437 WP_012028496.1.85908 WP_012028496.1.86151 WP_012028496.1.86177 WP_012028496.1.86836 WP_012028496.1.86842 WP_012028496.1.87044 WP_012028496.1.87321 WP_012028496.1.87344 WP_012028496.1.87438 WP_012028496.1.87450 WP_012028496.1.87819 WP_012028496.1.87874 WP_012028496.1.87885 WP_012028496.1.8790 WP_012028496.1.88543 WP_012028496.1.88575 WP_012028496.1.88653 WP_012028496.1.88779 WP_012028496.1.89037 WP_012028496.1.89038 WP_012028496.1.89056 WP_012028496.1.89128 WP_012028496.1.89156 WP_012028496.1.89279 WP_012028496.1.89358 WP_012028496.1.89388 WP_012028496.1.89800 WP_012028496.1.8993 WP_012028496.1.89989 WP_012028496.1.90172 WP_012028496.1.90419 WP_012028496.1.90742 WP_012028496.1.90961 WP_012028496.1.91238 WP_012028496.1.91636 WP_012028496.1.91865 WP_012028496.1.91912 WP_012028496.1.91973 WP_012028496.1.91983 WP_012028496.1.92134 WP_012028496.1.92263 WP_012028496.1.92441 WP_012028496.1.92554 WP_012028496.1.92692 WP_012028496.1.92722 WP_012028496.1.928 WP_012028496.1.92964 WP_012028496.1.93190 WP_012028496.1.93456 WP_012028496.1.93519 WP_012028496.1.9361 WP_012028496.1.93627 WP_012028496.1.93646 WP_012028496.1.9376 WP_012028496.1.93771 WP_012028496.1.94332 WP_012028496.1.94338 WP_012028496.1.94418 WP_012028496.1.94419 WP_012028496.1.94449 WP_012028496.1.9454 WP_012028496.1.94639 WP_012028496.1.94786 WP_012028496.1.94945 WP_012028496.1.95180 WP_012028496.1.95213 WP_012028496.1.95214 WP_012028496.1.95262 WP_012028496.1.95288 WP_012028496.1.95542 WP_012028496.1.95798 WP_012028496.1.96164 WP_012028496.1.96282 WP_012028496.1.96451 WP_012028496.1.9652 WP_012028496.1.96524 WP_012028496.1.96574 WP_012028496.1.96700 WP_012028496.1.97052 WP_012028496.1.97453 WP_012028496.1.97493 WP_012028496.1.97504 WP_012028496.1.97515 WP_012028496.1.97554 WP_012028496.1.97857 WP_012028496.1.9809 WP_012028496.1.9815 WP_012028496.1.98253 WP_012028496.1.98271 WP_012028496.1.98326 WP_012028496.1.98343 WP_012028496.1.98416 WP_012028496.1.98860 WP_012028496.1.98864 WP_012028496.1.98921 WP_012028496.1.99127 WP_012028496.1.9922 WP_012028496.1.99252 WP_012028496.1.99324 WP_012028496.1.99696 WP_012028496.1.99988 YP_003029457.1.79686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]